KEGG   Strongylocentrotus purpuratus (purple sea urchin): 584367Help
Entry
584367            CDS       T01019                                 

Definition
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase-like
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:spu00270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 185 aa AA seqDB search
MASMNVQAWFMGDSDADQREEHHCNPPEYVDEEYIGKHGIKFWKVNPDDYENDATYNKVR
ADRGYNYEDEITITKEKLPNYEEKIKKFFEEHLHLDEEIRFCLDGSGYFDFRDFKERWVR
MKFTKGLFFVLPAGIYHRFTLDTNNYVKAKRLFVGEPVWTPYNRPADEKPQRATFLESIK
HLTED
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atggccagtatgaatgttcaagcctggtttatgggggattctgatgccgatcagcgcgaa
gaacaccattgcaatccaccagaatacgtggacgaagaatacatcggcaagcatggcatc
aagttctggaaggtaaatcctgatgactatgagaatgatgcaacttacaacaaggtcagg
gctgaccgtggctataattatgaggatgagattaccatcaccaaagagaagcttcctaac
tatgaagagaagatcaagaagttctttgaagaacatcttcatttggacgaggagattcga
ttctgtctcgatgggagcggttactttgacttcagggatttcaaggagcgttgggtccgc
atgaagttcaccaaggggctcttctttgttcttccagccggcatctaccatcgcttcacc
ctggacaccaacaactatgtgaaggccaaacgtctgttcgttggtgagcctgtatggacg
ccctacaaccgcccagcagacgagaaaccccagagagccacgttcttagaatccatcaag
cacttgactgaagattaa

DBGET integrated database retrieval system