KEGG   Strongylocentrotus purpuratus (purple sea urchin): 584463Help
Entry
584463            CDS       T01019                                 

Definition
serine/threonine-protein kinase mos-like
Orthology
K04367  
proto-oncogene serine/threonine-protein kinase mos [EC:2.7.11.1]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Module
MAPK (ERK1/2) signaling
Brite
Enzymes [BR:spu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     584463
Protein kinases [BR:spu01001]
 Serine/threonine protein kinases: Other group
  MOS family
   584463
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 418 aa AA seqDB search
MTKIFEVILRLLSRHFAFLRIYQAYLQRTKRTISTENLLATRDCDSETFGLKRRRHTDCV
IKTREYHSAEVYCRDSNKRNKPVGLQSAFILKGDTEFQMEESMVNTNFRIITHQHASRTT
YHCVSDNNNDTVSVRPRDLLTDDFQVEGLIGSGGFGSVFVGKYCGRRVAVKVLRPRRKNA
EAMLQSFRAEVNALYLKHENIVNVLATSAVEDFEAGAFIIMEYAGKRNLQQLINEPSERL
PLARRANFALHIIRALQYTHAHNIAHLDVKPANIIVDDYDVCRLCDYGCSQQVFGSNGKG
LRSPTNRSYLTGTCGYRAPELLCGDAPTTKADIYSFGITLWQMLTRETPYAGENHHVVIF
GVVAKDMRPKLPGNENETENDWYRRLITKAWPKQPEDRPTARELLKELEMRLGVDDVA
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaaatatttgaggtgatactgaggcttttgtctcggcatttcgcctttctgcgg
atctaccaggcgtaccttcagcgcacgaagcggacaatttccacggaaaatcttttagcg
acgagggattgtgattcagagacgtttggcctcaaacgaagaagacataccgactgtgtg
ataaagaccagagaatatcactcagcagaggtatattgtcgagattcaaataagaggaat
aaaccagtgggattgcagagtgcctttattttaaaaggagatactgaatttcaaatggag
gagtcgatggtgaatacaaactttaggatcataacgcatcagcatgcgtcaaggacaaca
taccactgtgtctcggataataataatgatactgtttcagtgaggccgcgagatcttctt
acggacgactttcaggtcgaaggtttgatcggcagcggtggttttggatcggtgtttgtt
gggaagtactgcggtcgacgagtggccgtcaaggtgttacgaccacgccggaaaaacgct
gaagccatgctgcagagctttcgcgcagaagtcaacgccctgtacttaaagcatgagaac
atcgtcaatgtactagccacaagtgccgtagaggatttcgaggctggtgcttttatcatc
atggagtacgcggggaagaggaatctacagcaactgatcaatgaaccatccgaaaggtta
ccgctggcacgccgtgcaaattttgctcttcacatcatccgtgccttacaatacacccac
gcacataacatcgcccacttggacgtcaaaccagcaaatatcattgtagatgattatgac
gtatgtcgcttgtgtgattatggatgctctcagcaggtctttgggtcaaatggcaaaggt
cttcgaagtcctacgaatcggtcgtacttgaccggcacttgtgggtaccgcgccccggag
ctcttgtgtggtgacgcgccgacgaccaaagccgacatctattcgtttgggatcacactt
tggcagatgctgacgcgagagacgccatacgctggggagaatcatcacgtcgtcattttc
ggcgtcgtcgccaaggacatgcgcccgaagcttcccggcaacgagaacgagacggaaaac
gactggtatcgtcggctcatcacgaaggcctggccgaagcaacccgaagacagaccgact
gccagggagttactgaaagagctggagatgcgactcggtgtggacgacgtcgcttga

DBGET integrated database retrieval system