KEGG   Strongylocentrotus purpuratus (purple sea urchin): 584566Help
Entry
584566            CDS       T01019                                 

Definition
acyl-protein thioesterase 2-like
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:spu00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 430 aa AA seqDB search
MSGLFAPLRLPSRIPSLVSLTSILVQIQPISSLITGQQPISNHHTSSPAHTQQNPAPGVW
SESRRERDQPGNCPIRLGENLNRPISNQYMCGNSYSSMAACTGPALLPSAKHTATMSGLF
APLRLPSRIPSLVSLTSILVQIQPISSLITGQQPISNHHTSSPAHTQQNPAPGVWSKSRR
AGDQPGNCPIRSGENLNRPISNQYMCGNSYSSMAACTGPALLPSAKHTATVIFLHGLGDQ
GHGWCSSFEEIKEPHIKYIFPNAPNNPVTLNLGMVMPSWFDIISLGAEGKEDKEGILKAS
ANLLKMVAEEESHGIAPNRIVIGGFSQGGAVSLYSALTDDRPYAGVLALSTWMPLHQTFK
TDGVSKKPMPLLQCHGTSDNILPFSLGQMTHNLLQTQVSSPEFHKYPGLGHSSCSEEMLL
VRDFLKKVLP
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgtctggactgtttgctccactaagactaccaagcaggattccgtccctggttagtctc
acctctatcctggtccaaatccagccaatcagctctctcatcaccggccaacaaccaatc
agcaaccaccacacgtcaagccccgcccacacacagcagaatcccgcaccgggcgtttgg
agtgagagcaggagggaaagagaccagccggggaactgtccaatcagattgggagagaat
ttgaatcgtccaatcagcaaccagtacatgtgcggtaattcctactccagtatggccgct
tgcactggaccagccctgttgccttccgctaagcacacagctacgatgtctggactgttt
gctccactaagactaccaagcaggattccgtccctggttagtctcacctctatcctggtc
caaatccagccaatcagctctctcatcaccggccaacaaccaatcagcaaccaccacacg
tcaagccccgcccacacacagcagaatcccgcaccgggcgtttggagtaagagcaggagg
gcaggagaccagccggggaactgtccaatcagatcgggagagaatttgaatcgtccaatc
agcaaccagtacatgtgcggtaattcctactccagtatggccgcttgcactggaccagcc
ctattgccttccgctaagcacacagctacggtgatatttctgcatggacttggtgatcaa
ggccatggctggtgctcgtcatttgaagagatcaaagagcctcacatcaaatacatattt
cctaatgcacctaataatccggtcacgctgaacttgggtatggtgatgccgtcatggttt
gacatcatctcgttgggggccgaggggaaggaagacaaggagggtatcctgaaggcttcc
gcaaatttattaaaaatggttgcggaagaggaaagccacggtatcgcacctaatcgcatc
gtcataggaggtttctcacaagggggtgctgtttcactctactcggcattaacggacgac
aggccatatgccggtgtgttagcactcagtacatggatgcctctgcatcagacatttaaa
acggatggagtcagcaagaagcccatgcctctactgcaatgccatggaacctctgacaat
attcttcctttcagtctgggccagatgacccataatttgttacaaacccaggtctccagt
ccagagttccataaatatcctggtcttggacatagttcctgttctgaggaaatgctccta
gtacgcgatttcttgaagaaagtccttccgtag

DBGET integrated database retrieval system