KEGG   Strongylocentrotus purpuratus (purple sea urchin): 584869Help
Entry
584869            CDS       T01019                                 

Definition
(RefSeq) galactocerebrosidase
  KO
K01202  
galactosylceramidase [EC:3.2.1.46]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    584869
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    584869
Enzymes [BR:spu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.46  galactosylceramidase
     584869
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 468 aa AA seqDB search
MMGTQIVAADGGAYGGQAISKDILDDKDLAKAVEILGFHYPGTYVTKYTTETRKTLWSSE
DYSTKNDNIGAGCLARILNRNYVNGNITSTISWNLIASYYGSLPYDRCGLMTAREPWSGN
YVVEGPIWVTAHTTQFTLPGWKYYLRGSGAGHLDQGGSYVSLTDGKNFTIIIETMTRDHS
KCIRPFLPPYTVKTQTASFTLKGMFASIKSLNVFYSKPGYGGNSSVYFMKKSPVQVVNGQ
FNLTLDPDEIYTLTTQTVGMKGKYPDPPQPKPFPTKYTDNFDEYPIYSEANYFTDQAGCF
EIRDSGNISHNLVMQQVATSYPVNWCIDAHHPISVIGNHTWRDVSFSIDVHVLPSSGAIL
ALRVNAGGCGAAGSEGIFFWLCGSGRYNVTTDMGRDVVVSGTAPIIGNTWATVQLTVIGG
EAKGSVNGIEVFDWVNIPTVLPQHGWIAIGTPDYSAAQFDNFAIHSAS
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgatgggaactcaaatagtcgctgccgatgggggcgcctatgggggccaggccatcagt
aaagatatccttgacgacaaggatcttgctaaagctgttgaaatcttgggatttcattat
cccggtacgtacgtgactaaatacaccacagagacaagaaaaactctatggtccagtgaa
gactacagtacaaaaaacgacaacataggagcaggatgcttggcaaggatactgaaccgg
aactatgtgaatgggaatataacaagtacgatatcgtggaacctaatcgctagctactat
gggtctttaccctatgatcgctgtgggctaatgacggctagagagccttggtcgggcaac
tatgtggtggaaggccctatctgggttactgcacacaccacccagttcaccttgcctggc
tggaagtattacttacgaggatcaggagcaggtcaccttgaccagggaggaagctatgtc
agtcttactgatggcaagaacttcaccatcatcatagaaaccatgacacgtgatcattca
aaatgcatccgtccatttctgccaccatacactgtaaaaacacagactgctagcttcacc
ctgaaaggcatgtttgcctctatcaagtctctcaatgtgttctactccaagcctggctat
ggtgggaattcttcagtttatttcatgaagaaaagcccggttcaagtagtaaatggtcag
ttcaatttgacccttgaccctgatgaaatctacacactgaccactcagaccgttggtatg
aagggcaaataccctgaccctccccaacctaagcccttcccgaccaagtacacagacaat
ttcgatgagtacccaatctacagtgaggccaactattttacagaccaggctggttgcttt
gaaatccgagactctggaaacatcagtcacaacctcgtcatgcaacaagtggcaacctcc
tacccagtgaattggtgtattgacgcccatcacccaatctcggtgattggaaaccatacg
tggcgtgatgtgagctttagcattgacgttcatgtcttgccttcatctggagctatcctt
gctctccgtgtgaatgctggtggctgtggggcagcaggctcagaaggaatcttcttctgg
ctctgtggtagtgggaggtacaatgttaccacggacatggggagagatgttgtagtgagt
ggtacagctcccataattggcaatacctgggctacagttcagctaactgtcattggtgga
gaggccaaggggtctgtgaatggtattgaggtgtttgactgggtcaacattcctacagta
ctacctcaacatggatggatcgctataggaacaccagactattctgcagctcagtttgat
aactttgccatccattctgcatcttga

DBGET integrated database retrieval system