KEGG   Strongylocentrotus purpuratus (purple sea urchin): 585077Help
Entry
585077            CDS       T01019                                 

Definition
cGMP-dependent protein kinase egl-4-like
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Enzymes [BR:spu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     585077
Protein kinases [BR:spu01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   585077
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 543 aa AA seqDB search
MGPGKVFGELAILYNCTRTATITAVTDAQVWAIDRKVFQLIMMKTGMQRHEEYFNFLKSV
PLLKDLSSDNLFKLANSLEVDFFHEGEYIIVEGSRGDTFYIISKGEVRITQSVQGQREPQ
EVRSLQKGDFFGEKALLGEDVRTANVLASKGGCECLAVDRQSFNELIGNMQALQDKNYGD
KERGATSWYNLTINTLQEDDNKFKKSSSSEMDNTEIARIKPIQDELAAIHLNDLDIIATL
GVGGFGRVELVQLAGDKRTFALKCLKKHHIVETRQQEHIFSEKKIMMESSSPFIVKLFKT
FRDQKYIYMLMEVCLGGELWTILRDKGHFDDRTARFSTACVVEAFHYLHSRGIVYRDLKP
ENLLLDNKGYVKLVDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDLSCDYWSLGIL
IFELLTGNPPFTANDPMKTYNVILKGIDMVEFPRKIPRSAGNLIKRLCRDNPGERIGYQK
NGISDIKKHKWFQGFDWEGLRKQEIAAPLPPKVKGSSDCSNFDSYPKDVDIPADETSGWD
EHF
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgggaccgggaaaggtcttcggggaactggccatcctctataactgcaccagaacagcc
accatcactgccgtcactgacgcgcaagtatgggcgatcgatagaaaagtgttccagctg
atcatgatgaaaactgggatgcagcgccatgaagagtatttcaacttccttaagagtgtg
cctttgctcaaagatttgtcttccgataacctcttcaagttggcgaacagtttggaagta
gacttcttccatgaaggtgaatacattatagtggagggctccaggggagataccttctac
atcattagtaagggggaggtccggataacccaatccgtccaaggacagagagaaccccag
gaggttcgaagcctccagaaaggagacttcttcggtgagaaagcgctccttggtgaggac
gtacgaacagcgaatgtcttggccagcaaagggggatgcgagtgcttggccgttgataga
cagtctttcaacgaactgatcggcaacatgcaggcactccaggacaagaattatggagac
aaagaaaggggagcaaccagctggtacaatctaacaatcaacactctacaagaagatgac
aacaagtttaagaaatcgtcgagctcggagatggataatacagagattgcacgaatcaag
ccgatacaagatgagctagctgctatacatctcaacgatctggatatcatcgctacattg
ggtgttggagggttcggtcgggtcgaactggttcaactggcaggcgataagcggacattc
gccctcaagtgtttgaagaaacatcacatcgtagaaactcggcaacaggaacatatcttt
tctgagaagaagatcatgatggaatctagctccccctttattgtcaaattgttcaagaca
ttccgtgatcagaagtatatctacatgcttatggaagtctgcttaggaggagagctctgg
actatcctcagggacaagggtcattttgacgaccggacagcaaggttttccaccgcatgc
gtagttgaagctttccactatttgcacagtcgcggcatcgtctaccgcgatctcaagcct
gagaatctactccttgacaacaaaggctacgtcaaattggtcgactttggtttcgcgaag
aagatcggttttggtcgtaagacctggaccttttgtggcactcccgagtacgtggctccg
gaaatcatcctcaacaaaggtcatgacctgtcatgtgactactggtccctgggaatcctc
atctttgagctgttgaccggaaatccgccattcactgccaatgatcccatgaagacatac
aacgttattctaaagggtatcgacatggtcgagtttccacggaagattcctcgtagtgct
ggtaaccttatcaagcgactctgtcgggacaatccaggcgagagaatcggctaccagaag
aatggcattagtgatatcaagaagcacaaatggttccaaggttttgactgggaaggtctc
aggaagcaagaaattgccgcccctcttcctccaaaggtgaaaggctcaagcgactgcagc
aacttcgacagctacccgaaagatgtcgatatcccggccgatgaaacgtcgggatgggac
gaacacttttaa

DBGET integrated database retrieval system