KEGG   Strongylocentrotus purpuratus (purple sea urchin): 585201Help
Entry
585201            CDS       T01019                                 

Definition
histone acetyltransferase KAT8-like
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Enzymes [BR:spu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     585201
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 456 aa AA seqDB search
MAENADKPSAKGSTKAQENNMNSSLKDTDSKVTSPQNGSTNDSDNENDENSLKIGDTYLI
QRHDNTWHNAEIVQTRKNEQDSNKKEYYVHYKGLNRRMDEWVGKEKVNVQQPPQERQKSE
TGDSLDDSDRKITRNQKRKHDEINHVQKSFAEMDPTTAALEREHEAITKVKYVNRVQIGK
YEIDAWYFSPFPDDYGKQAKLWICEYCLKYMRFEKTFRKHLGDCLLKQPSGIEIYRRGSI
SVYEVNGKDHKLYCQNMCLLAKLFLDHKTLYFDVEPFLFYILTEVDRHGAHLVGFFSKEK
ESPDGNNVACILILPPFQRKGYGKFLIAFSYELSKLENCVGSPEKPLSDLGKLSYRSYWS
WVLLEILRDFKGTLSIRDLSQMTSITQPDIISTLQALNMIKYWKGQHVICVTPKLVEEHL
KSAQYKRPRLTVDTSCLRWQAPKKPMLHSRGQKMKK
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggccgagaatgcggacaaaccctcggcgaagggctccacaaaagcacaggaaaacaac
atgaattcttcactgaaagacacggattcgaaagtgacatcgccacagaatggtagcacc
aatgattcagacaatgaaaatgatgaaaactcgttgaaaatcggtgatacttacttgata
cagcggcacgacaacacgtggcacaatgccgagattgtgcagaccagaaagaatgaacag
gatagcaacaagaaggagtattatgtacactacaaaggactcaatcggcgcatggacgag
tgggtcgggaaagagaaggtgaacgtccaacagcccccccaggagaggcagaagtccgag
accggagactcgctggacgactcggacagaaagatcaccaggaaccagaagagaaaacac
gacgagatcaaccatgttcagaagagctttgcagaaatggatccaacgacagctgcattg
gaaagagagcatgaagctattaccaaagtcaagtacgtcaacagggttcagataggcaag
tacgagatcgatgcttggtacttctcgcctttcccggacgactacggcaagcaagccaag
ctctggatctgtgaatactgccttaagtacatgagatttgagaagacctttaggaagcac
ctgggtgattgcttattgaagcagccttcaggtatagagatctacaggagaggctccatc
tcagtgtacgaagtcaacggaaaagaccacaagctgtactgccaaaacatgtgtctactt
gccaagctcttcctggatcacaagacgctctactttgatgtggagccattcctcttctac
atcctgacagaggtcgacagacacggcgcccatctcgttggattcttctcaaaggagaag
gaatcgcctgacggtaacaacgtagcttgcattctcatcttacctccattccagaggaaa
ggatatggcaaattcctcatcgcattcagttatgagttgtcgaagttagagaactgtgtt
gggtcaccagagaaacccctatctgatcttgggaagctgagctatcgcagctactggtct
tgggttctcttggagattctgagggacttcaaaggaacattgtccatcagagacctaagc
caaatgacgagcatcacgcaacccgacatcatcagcaccctgcaggccctcaatatgata
aagtactggaaggggcagcacgtgatctgcgtcacccccaagctggtggaggaacacctc
aagagcgcccagtacaagaggcccagactcaccgtggacaccagctgtctccggtggcag
gcccccaagaaacccatgctccactcaagaggacagaagatgaagaagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system