KEGG   Strongylocentrotus purpuratus (purple sea urchin): 585201Help
Entry
585201            CDS       T01019                                 

Definition
(RefSeq) histone acetyltransferase KAT8
  KO
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Enzymes [BR:spu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     585201
Chromosome [BR:spu03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    585201
   HAT complexes
    NSL complex
     585201
    MSL complex
     585201
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 394 aa AA seqDB search
MAENADKPSAKGSTKAQENNMNSSLKDTDSKVTSPQNGSTNDSDNENDENSLKIGDTYLI
QRHDNTWHNAEIVQTRKNEQDSNKKEYYVHYKGLNRRMDEWVGKEKVNVQQPPQERQKSE
TGDSLDDSDRKITRNQKRKHDEINHVQKSFAEMDPTTAALEREHEAITKVKYVNRVQIGK
YEIDAWYFSPFPDDYGKQAKLWICEYCLKYMRFEKTFRKHLGDCLLKQPSGIEIYRRGSI
SVYEVNGKDHKLYCQNMCLLAKLFLDHKTLYFDVEPFLFYILTEVDRHGAHLVGFFSKEK
ESPDGNNVACILILPPFQRKGYGKFLIAFSYELSKLENCVGSPEKPLSDLGKLSYRSYWS
WVLLEILRDFKGTLSIRDLSQMTSITQPDIISTL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggccgagaatgcggacaaaccctcggcgaagggctccacaaaagcacaggaaaacaac
atgaattcttcactgaaagacacggattcgaaagtgacatcgccacagaatggtagcacc
aatgattcagacaatgaaaatgatgaaaactcgttgaaaatcggtgatacttacttgata
cagcggcacgacaacacgtggcacaatgccgagattgtgcagaccagaaagaatgaacag
gatagcaacaagaaggagtattatgtacactacaaaggactcaatcggcgcatggacgag
tgggtcgggaaagagaaggtgaacgtccaacagcccccccaggagaggcagaagtccgag
accggagactcgctggacgactcggacagaaagatcaccaggaaccagaagagaaaacac
gacgagatcaaccatgttcagaagagctttgcagaaatggatccaacgacagctgcattg
gaaagagagcatgaagctattaccaaagtcaagtacgtcaacagggttcagataggcaag
tacgagatcgatgcttggtacttctcgcctttcccggacgactacggcaagcaagccaag
ctctggatctgtgaatactgccttaagtacatgagatttgagaagacctttaggaagcac
ctgggtgattgcttattgaagcagccttcaggtatagagatctacaggagaggctccatc
tcagtgtacgaagtcaacggaaaagaccacaagctgtactgccaaaacatgtgtctactt
gccaagctcttcctggatcacaagacgctctactttgatgtggagccattcctcttctac
atcctgacagaggtcgacagacacggcgcccatctcgttggattcttctcaaaggagaag
gaatcgcctgacggtaacaacgtagcttgcattctcatcttacctccattccagaggaaa
ggatatggcaaattcctcatcgcattcagttatgagttgtcgaagttagagaactgtgtt
gggtcaccagagaaacccctatctgatcttgggaagctgagctatcgcagctactggtct
tgggttctcttggagattctgagggacttcaaaggaacattgtccatcagagacctaagc
caaatgacgagcatcacgcaacccgacatcatcagcaccctatag

DBGET integrated database retrieval system