KEGG   Strongylocentrotus purpuratus (purple sea urchin): 585357Help
Entry
585357            CDS       T01019                                 

Gene name
hadha
Definition
hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit
Orthology
K07515  
enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    585357 (hadha)
   01212 Fatty acid metabolism
    585357 (hadha)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    585357 (hadha)
   00650 Butanoate metabolism
    585357 (hadha)
  Lipid metabolism
   00062 Fatty acid elongation
    585357 (hadha)
   00071 Fatty acid degradation
    585357 (hadha)
   01040 Biosynthesis of unsaturated fatty acids
    585357 (hadha)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    585357 (hadha)
   00310 Lysine degradation
    585357 (hadha)
   00380 Tryptophan metabolism
    585357 (hadha)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    585357 (hadha)
Enzymes [BR:spu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     585357 (hadha)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     585357 (hadha)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 703 aa AA seqDB search
MASVRSLGALRALSWAKYSSLRGSLGMNTKRYFSASGTSQARSIVNYEVKEDVAVVRIND
PNAKVNTLNKQFNAEIEDVFHELWANDGVKSVVLVSSKPGNFIAGADINMLGACETADEV
TELSRNGHKMLEAMEKSNKPVVAAINGTCLGGGLEVALSCHYRIATKDRKTVLSAPEVML
GLLPGGGGTQRLPKLIGVPNSLDMMLTGKSIPAEKAKKMGLVDMLVSPLGPGVKPLDERN
IEYLEEVAIQAARDLAAGNIKTDKPKTMMQKLQDSIMGTQFVQDQMYKKVKAMVMKNTNG
LYPAPFKIIDCVRAGTDKGSEAGYLLEAQEFGNLAMTPHAKSLMGLFHGQVACKKNNYGK
PLKKVETLAILGAGLMGAGVAQVSVDKGMHVVLKDMSLQGLARGEQQVFGGLDKKVKRKK
LTSFERDTIMSNLTGQIDYTNFSKCDMVIEAVFEDLAIKHRVIKEVEASXPEHCVFAXNT
SALPITQIAEASMRPEKVVGMHYFSPVDKMQLLEIITTPKTSKDTTAAAVEVGLRQGKVI
IVVGDGPGFYTTRILGPMLSEAIRILQEGCSPKDLDKASTSFGFPVGTATLADEVGLDVA
SHIAKDLGQKFGERFGGGDPQVLHDMVQAGYMGRKSGKGCFVYSGSSKNREVNEGAQAIL
KTHALPRQGVDSVEDIQMRMVTRFVNEAVMCLQEGILRDPVSR
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atggcttctgtgcgatcacttggcgctctcagagctttatcttgggcaaaatactcgtct
ttgagaggaagcctgggaatgaacacaaaaagatatttctcagcatctggcacatcccaa
gctcgttcaatagtaaactatgaagtcaaagaagatgtggccgttgttcggattaacgac
cctaatgccaaggtgaatacattaaacaagcagttcaatgcagaaatagaagatgtcttt
catgaactctgggccaatgatggggtcaaatcagtggtgcttgtgtcatccaaaccagga
aacttcatcgcaggagcagacataaatatgctgggtgcatgtgaaacagcagatgaggta
acagaactttcaagaaatgggcacaagatgttagaggcaatggaaaagagtaacaagccc
gtagtcgctgccatcaatggcacatgcttgggaggaggacttgaggtcgctctgagctgc
cattaccgaatcgccaccaaggaccggaagacggtgctaagcgctcctgaggtaatgctt
ggactcctcccaggtggagggggtacccagagactacccaagctcatcggtgtacccaac
tctctagatatgatgctcaccggcaagagtataccggcagagaaggccaagaagatgggg
ctggtagacatgctggtctcccccttaggacctggggtaaagcctttggatgagaggaat
attgagtatttagaggaggtagccattcaagcagcaagagacctagccgcagggaacatc
aagacggacaaaccaaagacaatgatgcagaagctccaagactcaataatgggaacccag
ttcgtccaggaccagatgtacaagaaagtaaaagccatggtgatgaagaacacaaacggt
ctctacccagctccattcaagataatcgattgtgtcagagcaggtacagataaaggaagt
gaagccggatacctcctagaagctcaggagttcggcaatcttgcgatgacaccacacgca
aagtcattgatgggactattccatggtcaggttgcatgcaagaagaataactacggcaag
ccactgaagaaggtagagacccttgcgatccttggtgctggtctgatgggggcgggtgtg
gctcaagtcagcgttgataagggcatgcatgtcgttctcaaggacatgtcactccaaggc
cttgccagaggagagcaacaagtcttcggcggattggataaaaaagtgaagagaaagaag
ctaacaagttttgagagggataccatcatgtccaatctgactggtcagatcgactacacc
aactttagcaaatgtgacatggtgatcgaagccgtctttgaagacctagcaatcaagcac
agagtcattaaagaagttgaagcctcanttccggagcattgtgtatttgcatncaataca
tctgccttacccatcacacagatagcagaggccagtatgagaccagaaaaggttgttggc
atgcactacttctcacccgtcgacaaaatgcaactcctagagatcatcacaacgcccaag
acctccaaagacaccactgccgctgctgttgaggtaggcctcaggcaaggcaaggtaatc
atcgtggttggagatggaccaggcttctatacaaccaggattcttggccctatgctctca
gaggccatcaggattctacaggaaggatgcagccccaaggacctcgacaaagccagcact
tcctttggtttccccgtcggtacagccacgctggccgatgaagtaggtctggacgtcgcc
tcacacattgccaaagacttgggccagaagtttggtgagaggtttggtggtggtgatcct
caggtccttcatgacatggtgcaagcagggtacatgggtcgtaagagtggtaagggatgc
tttgtgtattcaggctcctccaagaaccgcgaggttaacgagggggcccaagccatcctg
aagacacacgccctcccgaggcagggtgtagacagtgtggaggatatccagatgaggatg
gtgaccaggttcgtcaacgaagcagtcatgtgcctacaggaaggcatcctcagggacccg
gtaagtcggtga

DBGET integrated database retrieval system