KEGG   Strongylocentrotus purpuratus (purple sea urchin): 585584Help
Entry
585584            CDS       T01019                                 

Definition
protein disulfide-isomerase A6-like
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:spu04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 452 aa AA seqDB search
MRLFIVLIAVGAASALFDTSDDVVELTAANFNQKVINGDEVWLVEFYAPWCGHCKNLAPE
WKKAATALKGVVKVGAVDMDVHSSVGAPYNVRGFPTIKVFGANKASPTDYNGARTATGII
ESALKTVKDMVNARSSGGGGGGRGSGGSGSGGSGSGGSGGKADDVVELTDGNFEKEVLNS
KDGVLVEFFAPWCGHCKSLAPEWAKAATELKGKMKLGALDATVHTVTASRYNVRGYPTLR
YFPAGVKDANSAEEYDGGRTATAIVAWALDKFSANIPPPEVMELIEQKVLTDSCDVKPLC
IISVLPHILDSGAVGRKQYLQILKGMGEKYKKKDWGWVWTSAGEHSKLEESLGIGGFGYP
AMAAVNTRKQKFSILKGSFSKEGIDEFMRTVSVGRGSSESIRGDALPSIETKEPWDGKDG
EMPEEDDIDLSDFDMDDDDEDEDVEVEKKDEL
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttgttcatagttttgatcgcggttggggctgcatctgccctctttgataccagt
gacgatgtggtggaactcacagctgccaattttaaccagaaagtcatcaacggtgatgaa
gtttggctcgtagagttctatgctccatggtgtggccactgtaaaaatctagctccagaa
tggaagaaggccgccactgctttgaagggtgtagtgaaagttggagctgttgacatggat
gtgcacagttcagtaggtgcaccgtacaatgtcaggggattccccaccatcaaggtcttt
ggtgccaacaaggccagccctacagattataatggtgcccgaacagccaccggaatcata
gaatcagcgctgaagactgtcaaggacatggtcaacgcaaggtccagtggtggaggaggt
ggtggaagaggtagcgggggcagcggtagcgggggcagcggtagtgggggcagcggggga
aaggcagatgatgtcgtcgagttgacagatggtaactttgagaaagaggttctgaacagc
aaagacggtgttttggttgagttctttgctccatggtgcggtcactgcaagtcgctagcc
ccagagtgggctaaagcggccaccgagctcaaaggcaagatgaaacttggagccttagat
gctacagtccatactgtgacggccagccgatacaatgttcgaggctaccccaccttaagg
tatttccccgccggtgtcaaagatgctaacagtgctgaggagtacgatggtggccgaaca
gcaacagccattgtcgcgtgggctctggacaaattcagtgccaatataccaccaccagaa
gtcatggagctcatagagcagaaggttttaaccgattcttgcgatgtaaagccactctgc
atcatctctgtcctccctcacattttggattctggagcggtgggtaggaagcaatactta
caaatcctcaaagggatgggagagaaatacaagaagaaggactggggatgggtctggaca
tctgcaggagagcactccaagttggaagagtcccttggcattggtggctttgggtaccct
gccatggcagctgttaacaccaggaaacaaaagttctctatcctcaaagggtcatttagc
aaagaaggaatcgatgaatttatgcgcactgtttctgttgggagaggctcatcagaatct
ataagaggggacgctttaccaagtattgaaaccaaagaaccctgggatggaaaggatgga
gagatgccggaggaagatgacattgaccttagtgactttgacatggatgatgatgatgaa
gatgaagatgtggaggtggagaagaaggatgaactttga

DBGET integrated database retrieval system