KEGG   Strongylocentrotus purpuratus (purple sea urchin): 585584Help
Entry
585584            CDS       T01019                                 

Definition
protein disulfide-isomerase A6-like
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:spu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    585584
Enzymes [BR:spu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     585584
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 452 aa AA seqDB search
MRLFIVLIAVGAASALFDTSDDVVELTAANFNQKVINGDEVWLVEFYAPWCGHCKNLAPE
WKKAATALKGVVKVGAVDMDVHSSVGAPYNVRGFPTIKVFGANKASPTDYNGARTATGII
ESALKTVKDMVNARSSGGGGGGRGSGGSGSGGSGSGGSGGKADDVVELTDGNFEKEVLNS
KDGVLVEFFAPWCGHCKSLAPEWAKAATELKGKMKLGALDATVHTVTASRYNVRGYPTLR
YFPAGVKDANSAEEYDGGRTATAIVAWALDKFSANIPPPEVMELIEQKVLTDSCDVKPLC
IISVLPHILDSGAVGRKQYLQILKGMGEKYKKKDWGWVWTSAGEHSKLEESLGIGGFGYP
AMAAVNTRKQKFSILKGSFSKEGIDEFMRTVSVGRGSSESIRGDALPSIETKEPWDGKDG
EMPEEDDIDLSDFDMDDDDEDEDVEVEKKDEL
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttgttcatagttttgatcgcggttggggctgcatctgccctctttgataccagt
gacgatgtggtggaactcacagctgccaattttaaccagaaagtcatcaacggtgatgaa
gtttggctcgtagagttctatgctccatggtgtggccactgtaaaaatctagctccagaa
tggaagaaggccgccactgctttgaagggtgtagtgaaagttggagctgttgacatggat
gtgcacagttcagtaggtgcaccgtacaatgtcaggggattccccaccatcaaggtcttt
ggtgccaacaaggccagccctacagattataatggtgcccgaacagccaccggaatcata
gaatcagcgctgaagactgtcaaggacatggtcaacgcaaggtccagtggtggaggaggt
ggtggaagaggtagcgggggcagcggtagcgggggcagcggtagtgggggcagcggggga
aaggcagatgatgtcgtcgagttgacagatggtaactttgagaaagaggttctgaacagc
aaagacggtgttttggttgagttctttgctccatggtgcggtcactgcaagtcgctagcc
ccagagtgggctaaagcggccaccgagctcaaaggcaagatgaaacttggagccttagat
gctacagtccatactgtgacggccagccgatacaatgttcgaggctaccccaccttaagg
tatttccccgccggtgtcaaagatgctaacagtgctgaggagtacgatggtggccgaaca
gcaacagccattgtcgcgtgggctctggacaaattcagtgccaatataccaccaccagaa
gtcatggagctcatagagcagaaggttttaaccgattcttgcgatgtaaagccactctgc
atcatctctgtcctccctcacattttggattctggagcggtgggtaggaagcaatactta
caaatcctcaaagggatgggagagaaatacaagaagaaggactggggatgggtctggaca
tctgcaggagagcactccaagttggaagagtcccttggcattggtggctttgggtaccct
gccatggcagctgttaacaccaggaaacaaaagttctctatcctcaaagggtcatttagc
aaagaaggaatcgatgaatttatgcgcactgtttctgttgggagaggctcatcagaatct
ataagaggggacgctttaccaagtattgaaaccaaagaaccctgggatggaaaggatgga
gagatgccggaggaagatgacattgaccttagtgactttgacatggatgatgatgatgaa
gatgaagatgtggaggtggagaagaaggatgaactttga

DBGET integrated database retrieval system