KEGG   Strongylocentrotus purpuratus (purple sea urchin): 585742Help
Entry
585742            CDS       T01019                                 

Definition
(RefSeq) acetyl-coenzyme A synthetase 2-like, mitochondrial
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    585742
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    585742
   00620 Pyruvate metabolism
    585742
   00640 Propanoate metabolism
    585742
Enzymes [BR:spu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     585742
Lipid biosynthesis proteins [BR:spu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   585742
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 468 aa AA seqDB search
MTTDQAVRGGKVIGLKATVDKAMEQCPKVKRVFVSKRTGADIPMYDRDIPMEEAMAQEST
ECEPEVLDSEDLLFMLYTSGSTGSPKGLAHSQAGYLLYASLTHKFVFDYQPGDVYACVAD
VGWITGHSYVVYGPLSNGATTVLFESIPTYPDPGRYWEMVERLKINQIYVAPTAVRLLLK
SGDSYVTKYDRSTLRTLGCVGEPLNHEAWDWYNNVVGEGRCSLADTWWQTETGGICITPR
PSAPNAEITGGPMRPFFGIEPALLDEKCREVTVNNEPGALCIRKPWPGIARTIYGNHKRY
LETYLSPYPGFYFSGDGAVRDDKGYYHITGRMDDVINVTGHRLGTAEVEDAMDEHPAVAE
TAVVGYPHDIKGEGVYAYVTLKDDVTESEGDIIKELKALVRQKIAAYAVPDIIQITPGLP
KTRSGKIMRRVLRKVSADQSDELGDVSTLADPSIVEIIVKNHDKVAKK
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgaccactgaccaggctgtgagaggaggaaaggtcatcggtctgaaggctactgtagac
aaagccatggagcagtgtccgaaggtcaagcgagtctttgtgtccaagaggactggagct
gacatccccatgtatgatagagatatacccatggaggaggctatggcacaagaatcaaca
gaatgtgaaccagaagtgttggacagtgaggatcttctcttcatgctttatacctcaggg
tctacagggtctcctaaaggtctcgctcattcacaagctggttaccttctctatgccagt
ctaactcacaagtttgtatttgactatcagcctggtgatgtctatgcgtgtgttgcagat
gtaggctggattactggacacagctatgtcgtatatggtcctctcagtaatggcgccaca
accgtgttgtttgaaagcattcccacctaccctgatccaggaagatattgggagatggta
gagaggctaaagatcaaccagatttatgtagcccctacagccgtgaggttgctactcaaa
tcaggagactcttatgtgacaaagtatgacagatctacattgagaacactgggatgtgtt
ggtgagccactgaaccacgaggcatgggattggtacaacaatgttgttggagaaggacgt
tgctcactagctgatacatggtggcagacagaaaccggtggtatatgtatcacgccacgc
ccatctgctcccaatgctgaaataacaggtggtcctatgcgccccttctttggaatcgaa
cccgctctccttgatgaaaagtgtcgggaagtcacagtgaacaatgagcctggcgccctc
tgcatccggaaaccatggccaggaatagcaagaaccatatatggcaatcacaaacgctac
ctggagacgtacctgagtccgtacccaggattctatttctctggtgatggtgcagtccga
gacgataaaggttactaccacatcacaggtagaatggatgatgtcatcaatgtcacaggt
catcgtctaggaacagcagaggtcgaggatgctatggatgagcatcctgccgtagcggag
acagctgtagtgggctacccgcatgacattaaaggagaaggtgtgtatgcatatgtgact
ctgaaggatgatgtgacagaaagcgaaggagatatcatcaaggaattaaaggctctagtc
agacagaagatcgctgcttatgctgttcctgatatcatccagatcactccaggactaccg
aagacacgctctggtaagatcatgcgacgtgtcctcaggaaggtgtcagctgatcagagc
gatgaactaggagacgtgtccaccttggctgatccttccatcgtagagatcatcgtaaag
aaccatgataaagtggccaagaaatag

DBGET integrated database retrieval system