KEGG   Strongylocentrotus purpuratus (purple sea urchin): 585817Help
Entry
585817            CDS       T01019                                 

Definition
dual specificity mitogen-activated protein kinase kinase 6-like
Orthology
K04433  
mitogen-activated protein kinase kinase 6 [EC:2.7.12.2]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Module
MAPK (p38) signaling
Brite
Enzymes [BR:spu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     585817
Protein kinases [BR:spu01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   585817
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 340 aa AA seqDB search
MATKGKKKFGGVKFKFDAEEAPKREEKKPPGGLDNKATLTVNGHEFQVYARDMIVIENLG
RGAYGIVDKTRHEPTESIMAVKKMRAQVNSTEDKRILMDMDVAMRSSDCVYTVEFYGALF
QEGDVWICMEVMDTCLDKLYKNKLKPQKIFVPENILSRISFSIVSALKYLQTRLKVIHRD
VKPSNVLANHNGKIKLCDFGISGQLVNSMAKTQDAGSRQYMAPERIDPDMSAKGYDVKSD
VWSFGITMIEIATNAYPYERWHDMFQQLTQVVKGTSPALPKEKFSEDIQDFINKCLKKNC
TERPSYTRLLEHEFIKQHADIGDDDVASFISPIIGDTNSS
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggctactaaaggtaaaaagaaatttggaggagtcaaattcaaatttgatgccgaagag
gctcctaagcgggaggagaaaaagccaccaggtgggctggacaacaaggctacactgaca
gtgaatgggcatgagtttcaggtgtatgccagagatatgattgtgattgagaatctagga
agaggagcatatggcatcgtggataaaactagacatgaacctactgaatccatcatggct
gttaagaaaatgcgagcccaggtaaacagcacagaggataaaaggattttaatggacatg
gacgtagctatgaggagttcagattgcgtgtacacagtagagttctatggtgctctcttc
caagagggagatgtatggatctgtatggaagtcatggatacatgtctcgacaaactctat
aagaacaaactcaaacctcaaaagatatttgttcctgaaaatatcctcagcaggatatct
ttctcaattgtgagtgccctcaaatatctgcagactagactgaaagtgattcacagagat
gtgaaaccatctaacgtactagctaatcacaatgggaagatcaagctctgtgactttggt
atcagcggtcaattggtcaactctatggccaaaacacaagatgcaggtagcagacagtat
atggctccagagaggatagaccctgacatgagtgctaaggggtatgatgtcaaatcagat
gtttggagttttggaatcacaatgattgagatagctactaatgcctacccatatgagaga
tggcatgatatgtttcagcagctcacacaggttgtaaagggcacttctccagcactacct
aaagagaaattctcagaagatatccaggatttcattaacaaatgtttgaaaaagaactgc
acagaaagaccttcatatacaagactattagaacatgaattcatcaagcagcatgctgac
ataggagacgacgatgtagccagcttcatatctcctatcatcggtgatacaaatagcagt
taa

DBGET integrated database retrieval system