KEGG   Strongylocentrotus purpuratus (purple sea urchin): 586067Help
Entry
586067            CDS       T01019                                 

Definition
3-hydroxybutyrate dehydrogenase type 2-like
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:spu00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:spu00072]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 216 aa AA seqDB search
MGRLAGKVAVVTAAAQGIGRATAQALAREGATVHATDINLEKLNELKDTKGKSGFVFNGT
VLDTEEKDFDFSFNLNVKSMFFLAKAVLPKMLEQNSGSIINMSSVASSIKGPPNRCLYST
TKAAVIGFTKAVAGDFVSKGIRCNAICPGTIDTPSLHQRMEATGDKEQAMKSFLARQPSG
RLGTPEEVANTVVFLASDESSFITGSEIKVDGGWAN
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgtttagctggaaaagttgcagttgtgacggcagctgcccaaggcattggaaga
gccactgctcaggcccttgctcgagaaggtgctactgttcatgcgacagatattaatctg
gagaagctgaatgaactcaaggatacaaaaggtaaatcaggatttgtcttcaatggcaca
gttctggacacggaggaaaaagactttgacttttctttcaacttgaacgtcaaatccatg
ttcttcctcgcaaaagctgtcttgcctaagatgttggaacagaatagtggcagtattatc
aacatgtcttctgtggcatcaagtataaaaggtcctcccaacaggtgcttgtattcaaca
accaaggcagcggtgataggtttcaccaaggcagtggctggagactttgtctccaagggg
atccgatgtaacgccatctgtcccgggaccatagatacaccctcccttcatcagagaatg
gaagctacgggggataaggagcaggccatgaagtcattccttgcccgtcagccctccggt
agacttggtactcctgaggaagtcgccaatacagtagtctttctcgcttctgatgagtcc
agcttcatcaccgggtccgaaatcaaagtagacggaggatgggccaattaa

DBGET integrated database retrieval system