KEGG   Strongylocentrotus purpuratus (purple sea urchin): 586067Help
Entry
586067            CDS       T01019                                 

Definition
3-hydroxybutyrate dehydrogenase type 2-like
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    586067
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    586067
Enzymes [BR:spu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     586067
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 216 aa AA seqDB search
MGRLAGKVAVVTAAAQGIGRATAQALAREGATVHATDINLEKLNELKDTKGKSGFVFNGT
VLDTEEKDFDFSFNLNVKSMFFLAKAVLPKMLEQNSGSIINMSSVASSIKGPPNRCLYST
TKAAVIGFTKAVAGDFVSKGIRCNAICPGTIDTPSLHQRMEATGDKEQAMKSFLARQPSG
RLGTPEEVANTVVFLASDESSFITGSEIKVDGGWAN
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgtttagctggaaaagttgcagttgtgacggcagctgcccaaggcattggaaga
gccactgctcaggcccttgctcgagaaggtgctactgttcatgcgacagatattaatctg
gagaagctgaatgaactcaaggatacaaaaggtaaatcaggatttgtcttcaatggcaca
gttctggacacggaggaaaaagactttgacttttctttcaacttgaacgtcaaatccatg
ttcttcctcgcaaaagctgtcttgcctaagatgttggaacagaatagtggcagtattatc
aacatgtcttctgtggcatcaagtataaaaggtcctcccaacaggtgcttgtattcaaca
accaaggcagcggtgataggtttcaccaaggcagtggctggagactttgtctccaagggg
atccgatgtaacgccatctgtcccgggaccatagatacaccctcccttcatcagagaatg
gaagctacgggggataaggagcaggccatgaagtcattccttgcccgtcagccctccggt
agacttggtactcctgaggaagtcgccaatacagtagtctttctcgcttctgatgagtcc
agcttcatcaccgggtccgaaatcaaagtagacggaggatgggccaattaa

DBGET integrated database retrieval system