KEGG   Strongylocentrotus purpuratus (purple sea urchin): 586135Help
Entry
586135            CDS       T01019                                 

Definition
(RefSeq) regulatory-associated protein of mTOR
  KO
K07204  
regulatory associated protein of mTOR
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:spu00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    586135
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 1243 aa AA seqDB search
MYEDITESEESDLCDWQLPLAYMKKRHTDPIEGSKTETQTWRMKERMKTVSVALVICLNV
GVDPPDTVKTSPCARLECWIDPLALSPSKALEAIGTSLQKQYERWQPRARYKQTLDPTVD
EVKKLCTSLRRNAKEERVLFHYNGHGVPRPTTNGEVWVFNKNYTQYIPLSVYDLQTWMGS
PSIFVYDCSNAGLILESFEQFSVQKEQDRELVGKSPTPINRTQVPLPPPPXNCIQLAACG
SNELLPMNPELPADLFTACLTTPIKIALRWFCNQRSSYLVPGVTQELVDKIPGRLNDRRT
PLGELNCIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERILRTYNCTPVSS
PRLPPTYQHPMWQAWDLAVDACLSQLPTLAKGAEYKHSPFFAEQLTAFQVWLGMGSEIRE
PPEQLPIVLQVLLSQVHRSRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLLQSSARELR
PLLVFIWAKILAVDRSCKADLVKDMGHKYFLSVLADPYMVAEHRTMAAFVLAMIVEDYQN
GQEAAFQGNVIAICLEQLNDQHPLLRQWLALCIARVWTNYNAARWCGVRDSAHEKLYKLL
NDPIPEVRAAATIALGTFIGNGTDRTDHAMTINHNIGVTLLSVANDGSAIVRQELVVALY
QLIKQSETQFATIARQLLDEEQSSDENLAPRSAAVTSDHLRRASVAVTNTASRKSISILP
RTSSGNNLQHLNGATVAKSPSSSSSSPGSGDFLSTPTLNGKGLPRVPSSSSLSSNVFVQM
WRVILLLTHDPHPKVKELAQTLVNAINLKATISAKPQLVRDSRKTSSAPSSPTRNSQSSP
PQDMSDSPPLNIPNEIMRPVPIKPWEQPPPERPQNPGPIDAQYPGPSPTLHSQRFTRTRK
LHDRGPSVTYEEVEDVMTTKNLTITTEFSDWCCKYFAQSVMKAPEEMDPFSGLHHMREWR
FVRNARIRNETREQLKKAKSCHLDDQIFINKNSAVPYVVKFHPFNPHAIVADREGVCVWN
WESGERLNYFLNKNPKHSKITSMDILNSHDLALVMTGADDGSVRIWRNYWTPDGRPVELV
TAWQALSDMLISNRGSGLVLDWEQGSGMLLASGDVRTIRVWDTQRELKLQDIPTGADSCV
TSLACDSVGRSLLIAGCGDGSVRLYDRRLAPQECRVMTLREHQSWVSNVHLQKGAGDGKI
ISAGLGGDVRFWDPRFTESVKVVNTAPDLTTMEVHPHAGIFAW
NT seq 3732 nt NT seq  +upstreamnt  +downstreamnt
atgtatgaggacatcacggaatcggaggagagcgacttgtgtgactggcagctgccgctt
gcatacatgaagaaacgacacacagacccaatcgaaggaagcaaaacagaaacacaaaca
tggcgaatgaaagaacggatgaagacagtgagtgtagctcttgtgatatgtctcaacgtt
ggtgtggacccccctgacacagtcaaaacttcaccgtgtgcaaggctagaatgctggata
gacccacttgctcttagcccatccaaggctctcgaggccataggtaccagtttacagaag
cagtatgaaagatggcagcctcgggctcgttacaagcagacccttgaccccacagtggat
gaggtcaagaagctctgtacctccctgagacgtaatgccaaggaagagagggttctgttc
cactacaatggccatggggttcctagaccaaccaccaatggagaggtctgggtattcaac
aagaattacacccagtacatcccgctatccgtatatgaccttcagacctggatgggcagt
ccgtctatctttgtctacgactgctccaatgcaggacttatcctggaatcctttgagcag
ttctctgtacagaaggagcaggacagagagcttgtggggaagagccccaccccgataaac
aggacccaggtgcccctgcccccaccgccctagaactgcatccagctggctgcgtgcggc
tccaatgaactccttcctatgaatcccgagcttcctgccgatctcttcacagcttgcctc
accacacccatcaagattgcattgagatggttttgtaatcagaggagtagctacctggtg
ccaggagtcacacaagaacttgtagacaagattccaggaaggttaaatgataggagaaca
ccactgggtgaactcaattgtatcttcactgcaatcacagacactatagcatggaatgta
ttacctagagatctattccagaaactattcagacaagacttgttggtagccagcctcttc
aggaatttcctcttggcagagaggattcttcgtacatacaactgcactccagtgtcgagt
cccaggctaccacccacataccaacatccgatgtggcaagcatgggacctagcagtcgat
gcctgtctctctcaactcccaaccctggccaaaggtgcagagtacaagcacagtcctttc
ttcgctgagcagctcacagccttccaggtctggctaggtatggggtcggagatcagagaa
ccaccagaacaactcccaatcgtgcttcaggttctgttgagtcaggtgcacagatcaagg
gctttagatctccttggtcggttcctagatctaggaccatgggctgtcagtctggccttg
tcagtgggtatcttcccctacgtcctgaagctccttcagagttcggccagggagctgaga
ccgctccttgtcttcatctgggcaaagattctagcagtggataggtcttgtaaagctgac
ctagtgaaagacatgggtcacaaatacttcctctccgttctggcagatccctacatggtg
gctgagcacagaacaatggctgcctttgtattagctatgatagttgaggattaccagaac
ggacaggaagcagcgtttcagggtaacgttatagcgatctgtctggagcagctaaacgac
cagcaccctctactcagacagtggctagctctgtgtatagccagggtatggaccaactac
aatgcggcaagatggtgcggtgtgagggacagtgctcatgagaagctatacaagctactc
aatgaccctataccagaggtgagggctgcagcaaccatagctctgggaacattcataggc
aatggaacagatcggactgaccatgccatgaccatcaatcataatataggagttacattg
ctttctgtggccaatgatggaagtgcaatagtaaggcaggaactcgtggtggcgctctac
cagttaatcaagcagtcggagacccagtttgcgaccatcgcccggcagctgctagacgag
gagcagagctcggatgagaacctggcgccacggagcgcagcagtcacgtctgaccattta
cgtcgcgcctcagtggccgtcacgaacaccgccagccggaagtccatctctatcctcccc
cgaacgtccagcggaaacaacctgcagcacctcaacggtgccacagttgccaagtcaccg
tcaagcagcagttcttcaccgggcagtggggacttccttagtactccaacccttaacgga
aaagggttaccaagagtgccgtcaagctcctccctgtcatccaacgtctttgtccagatg
tggagggtcattctgctcttgacccatgacccccatccaaaggtcaaggagctagcccag
accctggtcaatgcgatcaatctcaaggcaaccatctctgccaaaccacagctggtgagg
gatagtaggaagacaagctctgcaccgtctagtcctaccaggaactcacagtcatcacca
ccacaggacatgagtgattcaccacccctgaacatccccaatgagatcatgagacccgtt
cccatcaagccctgggagcagccccctccagagagaccccagaaccccggccccatcgac
gcccagtatcctggcccctcacccaccctccactcacagcgattcaccaggaccaggaag
ctgcacgacaggggaccaagcgtgacgtatgaggaggtagaagatgttatgactaccaag
aatcttaccatcactacagagttctctgactggtgctgcaagtactttgctcagtcggtc
atgaaggctccagaagagatggatccgttcagtggtctacatcacatgagagaatggagg
tttgtacgtaacgccaggatacgcaatgagacgagggaacaactcaagaaagccaaatct
tgccatttagacgatcagatcttcatcaacaagaattcagctgtgccctatgtggtcaag
ttccatccattcaacccccatgctatcgtagctgacagggaaggtgtatgtgtatggaac
tgggagagcggtgaaagattaaactacttcctcaacaagaaccccaagcattcaaagatt
acctctatggatatactcaactctcacgacctagcgctagttatgacaggagcagatgac
ggatcagtgcgtatatggaggaattactggacgccggacgggaggcctgtcgagcttgta
acagcttggcaagccttgtctgatatgctgatctctaatagaggttctggtctagttctc
gattgggagcagggatcagggatgcttctagcctcaggggatgtcaggacgatacgggtc
tgggatactcagagagaactcaagctacaggatatccccacaggtgcagatagctgtgtt
acaagccttgcatgtgactcagtgggaaggtctctacttatagcagggtgtggggacgga
tcagtcaggctgtacgacagaagactagctccacaagaatgtcgagtgatgacattacga
gagcatcagagctgggtttctaatgttcatctacagaagggagcaggagatggcaagatc
atcagtgctggtcttggaggtgatgtccgattctgggaccctcgattcacagagtcagtg
aaggtagtcaacacagctccagatctaactaccatggaagtccacccacatgcaggaata
tttgcctggtaa

DBGET integrated database retrieval system