KEGG   Strongylocentrotus purpuratus (purple sea urchin): 586315Help
Entry
586315            CDS       T01019                                 

Definition
(RefSeq) 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial
  KO
K05605  3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
spu00280  Valine, leucine and isoleucine degradation
spu00410  beta-Alanine metabolism
spu00640  Propanoate metabolism
spu01100  Metabolic pathways
spu01200  Carbon metabolism
Module
spu_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    586315
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    586315
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    586315
Enzymes [BR:spu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     586315
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_2 ECH_1 FliG_N HD_3
Motif
Other DBs
NCBI-GeneID: 586315
NCBI-ProteinID: XP_011665933
Position
Un
AA seq 382 aa AA seqDB search
MLVSRSLRRISLQRVSVILGQMRMSSTAGTEEDALFEKINSTGIITLNRPKALNALDFSM
VKKITPKLKEWCEDPSTSVVIIKGSGDKAFCAGGDIKAVTEAGKAGDPLAGEFFKNEYIL
NHTIGTMKKPYIAFIHGITMGGGVGLSVHGRYRVATEKTLFAMPETAIGLFPDVGGGYFL
PRLDGKLGIYLALTGYRLKGRDVLHAGVATHFVEAQKLPELEQELCSLQSPQHAQVQQVL
QKFHQQCSIDADKPFSLAPHKSSIDRLFEADTVEAIFQNLEQDGSEWATKQLETLKKMSP
TSMKITLRQLIEGAKLTLGNCLSMEYRIAEGCIRGHDFYEGVRAVLIEKDHTPKWSPATL
EEVDETIVTSHFRPLGKQELLF
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgttggtatcaagaagtctgagaagaatatcactgcagcgtgtatcagtcatccttgga
caaatgaggatgtcgtcgactgcaggtacagaggaagatgccctctttgagaagatcaat
tcaaccggcatcatcacactgaacagaccaaaggccctcaatgctctggacttttctatg
gtcaagaaaataacaccaaagctaaaagaatggtgtgaggatccctctacctcggttgtt
atcataaaaggctctggagacaaagctttctgtgcaggaggtgatatcaaagctgtaaca
gaagcaggcaaagctggtgatcctctggctggtgaattcttcaagaatgagtacatcttg
aaccacaccattggcacaatgaagaaaccatacatagcattcatccatggcattacgatg
ggagggggtgtaggtctctctgtccatgggcgataccgagtagcaaccgagaagacactc
tttgctatgcctgagactgccataggactcttccctgatgtaggagggggttacttctta
cccaggctcgatggtaaacttggcatctacttggctctaactggctacaggttgaaaggt
cgtgatgtcctgcatgctggagtagctacacactttgtagaagctcaaaaattaccagaa
ttggagcaagaactgtgtagtttacaatcacctcaacatgctcaagttcaacaagtgcta
caaaaattccatcaacagtgttccatagatgcagacaaacccttctcattggctcctcat
aaatccagtatagacaggctgtttgaagcagacactgtagaagccatattccagaacctt
gagcaagatggatcagaatgggctactaaacaacttgagacacttaaaaagatgtcaccc
acctcaatgaaaatcaccttgcgacagctgatagagggcgccaaactgacactaggaaac
tgcctctcaatggagtataggattgcagagggatgcattagagggcatgatttctacgag
ggagtgcgagctgttctgattgaaaaggaccacacccctaaatggtcgccagcaacgcta
gaagaagtcgatgagaccatcgtcacaagtcattttagaccgcttggcaaacaagaactt
ctattttaa

DBGET integrated database retrieval system