KEGG   Strongylocentrotus purpuratus (purple sea urchin): 586315Help
Entry
586315            CDS       T01019                                 

Definition
3-hydroxyisobutyryl-CoA hydrolase, mitochondrial-like
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    586315
  Carbohydrate metabolism
   00640 Propanoate metabolism
    586315
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    586315
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    586315
Enzymes [BR:spu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     586315
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 382 aa AA seqDB search
MLVSRSLRRISLQRVSVILGQMRMSSTAGTEEDALFEKINSTGIITLNRPKALNALDFSM
VKKITPKLKEWCEDPSTSVVIIKGSGDKAFCAGGDIKAVTEAGKAGDPLAGEFFKNEYIL
NHTIGTMKKPYIAFIHGITMGGGVGLSVHGRYRVATEKTLFAMPETAIGLFPDVGGGYFL
PRLDGKLGIYLALTGYRLKGRDVLHAGVATHFVEAQKLPELEQELCSLQSPQHAQVQQVL
QKFHQQCSIDADKPFSLAPHKSSIDRLFEADTVEAIFQNLEQDGSEWATKQLETLKKMSP
TSMKITLRQLIEGAKLTLGNCLSMEYRIAEGCIRGHDFYEGVRAVLIEKDHTPKWSPATL
EEVDETIVTSHFRPLGKQELLF
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgttggtatcaagaagtctgagaagaatatcactgcagcgtgtatcagtcatccttgga
caaatgaggatgtcgtcgactgcaggtacagaggaagatgccctctttgagaagatcaat
tcaaccggcatcatcacactgaacagaccaaaggccctcaatgctctggacttttctatg
gtcaagaaaataacaccaaagctaaaagaatggtgtgaggatccctctacctcggttgtt
atcataaaaggctctggagacaaagctttctgtgcaggaggtgatatcaaagctgtaaca
gaagcaggcaaagctggtgatcctctggctggtgaattcttcaagaatgagtacatcttg
aaccacaccattggcacaatgaagaaaccatacatagcattcatccatggcattacgatg
ggagggggtgtaggtctctctgtccatgggcgataccgagtagcaaccgagaagacactc
tttgctatgcctgagactgccataggactcttccctgatgtaggagggggttacttctta
cccaggctcgatggtaaacttggcatctacttggctctaactggctacaggttgaaaggt
cgtgatgtcctgcatgctggagtagctacacactttgtagaagctcaaaaattaccagaa
ttggagcaagaactgtgtagtttacaatcacctcaacatgctcaagttcaacaagtgcta
caaaaattccatcaacagtgttccatagatgcagacaaacccttctcattggctcctcat
aaatccagtatagacaggctgtttgaagcagacactgtagaagccatattccagaacctt
gagcaagatggatcagaatgggctactaaacaacttgagacacttaaaaagatgtcaccc
acctcaatgaaaatcaccttgcgacagctgatagagggcgccaaactgacactaggaaac
tgcctctcaatggagtataggattgcagagggatgcattagagggcatgatttctacgag
ggagtgcgagctgttctgattgaaaaggaccacacccctaaatggtcgccagcaacgcta
gaagaagtcgatgagaccatcgtcacaagtcattttagaccgcttggcaaacaagaactt
ctattttaa

DBGET integrated database retrieval system