KEGG   Strongylocentrotus purpuratus (purple sea urchin): 586320Help
Entry
586320            CDS       T01019                                 

Definition
dopamine beta-hydroxylase-like
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Tyrosine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:spu00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 442 aa AA seqDB search
RGTTHLLFLRGPGSWPQNDTVESSVAPLHHSLRRVTLLKPERPIPSFPSDTKIIEVTVDD
ITVPDDDTTYWCKVSKFPDAEVKHHIVKYEVEVTEGNEDLVHHIEVYHCDVDPDVEVSLY
QGPCDDRPAGSSSLACSQVIGAWAMGAEAFVYPEEAGIAIGGPTTSSYIMIEIHYNNPAR
KAGIVDSSGLRFYYTPTLRPFDAGIIELGLVYTPKLSIPPEMDEFILTGHCLPRCTGKGL
PRRGIKAFASQLHTHLTGTAVWTKHVRDGIEQPELNRDDHFSSDFQEIRMLPKPVHILPG
DTLVTSCRYDTSDKDNVTMGGFSITDEMCVNYVHYYPRTPLEVCKSTISKRILRNFFYWA
NGHEEDVADDMSDEEIVEGFQSLEWTGETKKVWQEIVHQTNVDMDCFRPAGVPFTGKWNN
MEREEIRTHLPQISDECSTTDD
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
aggggtaccacgcacctcctctttctccgcgggcctggttcttggccccagaacgacact
gtggagtcctccgttgcacccctccaccactccctacgaagggtaacgctcctgaagccg
gagcgaccaattccaagcttcccatctgataccaagatcattgaggttacggtcgacgat
atcacggttcctgatgatgatacgacttattggtgcaaagtttcaaagtttcccgatgca
gaagtaaaacatcacatcgtaaagtatgaggtagaggtaacggaaggcaacgaggatctc
gttcatcacatcgaggtctaccattgtgacgtcgatcccgatgtcgaagtatctctctac
cagggtccctgtgatgatcgtccggccgggtcttccagtttggcgtgtagccaggtcatt
ggcgcttgggccatgggggcagaggcattcgtgtaccctgaagaggcaggcattgctata
ggaggaccaacaacatcaagctacatcatgatagagattcattataacaacccggccaga
aaagcaggtatcgtggatagttccggtcttcgcttctactacacacctaccctgagacca
tttgacgctggtatcattgagctgggtctagtctacacccccaagctctcgataccacca
gagatggatgaattcattctgaccggacactgtctaccaagatgcacaggaaagggtttg
ccgcgacggggtattaaagcgtttgcatcccagctgcacacccatttgacaggcacggcg
gtttggaccaaacatgtccgagacgggatagaacaacctgagcttaatagagacgatcat
tttagctcggacttccaggaaatccgaatgttaccaaaaccagttcatatcttgccaggt
gacactctagtaacctcttgccgatacgacacgagtgacaaagataacgtgacgatgggt
ggtttcagtatcacggatgagatgtgtgtaaactacgttcactattatccacgcacccca
ctggaggtctgtaaaagcaccatctccaaaaggattctcagaaatttcttctactgggca
aacggccatgaagaagacgttgccgacgacatgtccgatgaggagatcgtagagggattc
caaagtctagagtggacgggagaaacgaagaaggtctggcaggagatcgtccaccaaacc
aacgtcgacatggactgctttcgaccagctggcgttccgtttacagggaaatggaacaac
atggaaagagaagagattcggacccatctaccccaaatctcggacgagtgttcaacaaca
gatgattga

DBGET integrated database retrieval system