KEGG   Strongylocentrotus purpuratus (purple sea urchin): 586320Help
Entry
586320            CDS       T01019                                 

Definition
dopamine beta-hydroxylase-like
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    586320
Enzymes [BR:spu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     586320
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 442 aa AA seqDB search
RGTTHLLFLRGPGSWPQNDTVESSVAPLHHSLRRVTLLKPERPIPSFPSDTKIIEVTVDD
ITVPDDDTTYWCKVSKFPDAEVKHHIVKYEVEVTEGNEDLVHHIEVYHCDVDPDVEVSLY
QGPCDDRPAGSSSLACSQVIGAWAMGAEAFVYPEEAGIAIGGPTTSSYIMIEIHYNNPAR
KAGIVDSSGLRFYYTPTLRPFDAGIIELGLVYTPKLSIPPEMDEFILTGHCLPRCTGKGL
PRRGIKAFASQLHTHLTGTAVWTKHVRDGIEQPELNRDDHFSSDFQEIRMLPKPVHILPG
DTLVTSCRYDTSDKDNVTMGGFSITDEMCVNYVHYYPRTPLEVCKSTISKRILRNFFYWA
NGHEEDVADDMSDEEIVEGFQSLEWTGETKKVWQEIVHQTNVDMDCFRPAGVPFTGKWNN
MEREEIRTHLPQISDECSTTDD
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
aggggtaccacgcacctcctctttctccgcgggcctggttcttggccccagaacgacact
gtggagtcctccgttgcacccctccaccactccctacgaagggtaacgctcctgaagccg
gagcgaccaattccaagcttcccatctgataccaagatcattgaggttacggtcgacgat
atcacggttcctgatgatgatacgacttattggtgcaaagtttcaaagtttcccgatgca
gaagtaaaacatcacatcgtaaagtatgaggtagaggtaacggaaggcaacgaggatctc
gttcatcacatcgaggtctaccattgtgacgtcgatcccgatgtcgaagtatctctctac
cagggtccctgtgatgatcgtccggccgggtcttccagtttggcgtgtagccaggtcatt
ggcgcttgggccatgggggcagaggcattcgtgtaccctgaagaggcaggcattgctata
ggaggaccaacaacatcaagctacatcatgatagagattcattataacaacccggccaga
aaagcaggtatcgtggatagttccggtcttcgcttctactacacacctaccctgagacca
tttgacgctggtatcattgagctgggtctagtctacacccccaagctctcgataccacca
gagatggatgaattcattctgaccggacactgtctaccaagatgcacaggaaagggtttg
ccgcgacggggtattaaagcgtttgcatcccagctgcacacccatttgacaggcacggcg
gtttggaccaaacatgtccgagacgggatagaacaacctgagcttaatagagacgatcat
tttagctcggacttccaggaaatccgaatgttaccaaaaccagttcatatcttgccaggt
gacactctagtaacctcttgccgatacgacacgagtgacaaagataacgtgacgatgggt
ggtttcagtatcacggatgagatgtgtgtaaactacgttcactattatccacgcacccca
ctggaggtctgtaaaagcaccatctccaaaaggattctcagaaatttcttctactgggca
aacggccatgaagaagacgttgccgacgacatgtccgatgaggagatcgtagagggattc
caaagtctagagtggacgggagaaacgaagaaggtctggcaggagatcgtccaccaaacc
aacgtcgacatggactgctttcgaccagctggcgttccgtttacagggaaatggaacaac
atggaaagagaagagattcggacccatctaccccaaatctcggacgagtgttcaacaaca
gatgattga

DBGET integrated database retrieval system