KEGG   Strongylocentrotus purpuratus (purple sea urchin): 586323Help
Entry
586323            CDS       T01019                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 48
  KO
K11858  
ubiquitin carboxyl-terminal hydrolase 48 [EC:3.4.19.12]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Enzymes [BR:spu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     586323
Peptidases [BR:spu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   586323
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1240 aa AA seqDB search
MPSKSASDKEIWRWTETTSPDEVTEEHVRVAYRVNLPICSTSCRRNCKGNPNCLVNLGEK
EWLKEIRDEHWYQMDDPEEEKRTKEDLVGLKNLGATCYVNTFLQDAQEFSKLLISLLEGT
LKEQPNARDAQEFSKLLISLLEGTLKEQPNARVRNVIEQQFSGQYSYVTSSDGVLAAIPD
ESLQPTSICGHLQLLFALLQFSKRRYIDPSNFINCLGLDAALQQDAQEFSKLLISLLEGT
LKEQPNARVRNVIEQQFSGQYSYVTRCNHCGNCSERPSRFYELDLNIKGHKQLEDSLSEF
LKEEKLEGANQYLCEKCNCKRNATRCIKLQTLPPVLNIQLLRFVFDRHSGTKKKLNNFLQ
FPEEIDMSKHLARRDNSAMYDLEAVLIHRGPTAYSGHYVAHIRSHGDGGVWFKFNDEEIQ
KMEGKNLKLGCEDELSAGKEGKRPKVPKGNHASKNAYMLVYKRRSTDQRESHVDNSSTVT
SVENNSAMYDLEAVLIHRGPTAYSGHYVAHIRSHGDGGVWFKFNDEEIQKMEGKNLKLGC
EDELSAGKEGKRPKVPKGNHASKNAYMLVYKRRSTDQRGTESHVDNSTTTSNVESLPDYL
QELIGRDNGEATEWLRNGLHYEDETTGSKVGPINNYKFECKFKNLDPHKVKELKRISSKA
ADLLFAKYGSDGLQLRMTQSKMCLACVKQKCQVMRIQAQLVADQKFVTDNTKAKCQSEDG
FWVGKDSLKQWKRMAVEKVESQFDGEGGATEGEEDMEIDDEDQALPNGKSSAAGATEGGE
NGAPPKENGERKDEQDEEEEEEDEEPLVFNEDLLCPHGNLSTDMSQRRLVFAPVWEVLRK
YFPESSEFKADSQHCLQCHVKNGEQKDEQDEEEEEEDEEPLVFNEDLLCPHGNLSTDMSQ
RRLVFAPVWEVLRKYFPESSEFKADSQHCLQCHLADAEDAEQAQQRCDLATEQKKSLSQL
FHGRSRPAWKKGESMEVYVAPLPFVEAWRSFLRHPVKADLPTDIVNSSFICAHNGLILDP
STISPIDETSGVALVWPYEWEILKANFIVDQPIRIWKVIADEPCFITEPDLCQTCSQERQ
LAEHQARFTYSGVKLYIRKYMPEVGENAKAAINFLMEATSPGGSSDQENKDPDFQQNDPK
RMKLELDNSSSSRRSSRHRRVRGEKEVMVSSTNTLKELKIKVMHAFSVAPFDQTLLFRGK
PLQDNEATLSHLGVTPEALITLIVDSPICEDPLAMDEIAR
NT seq 3721 nt NT seq  +upstreamnt  +downstreamnt
atgccaagcaaatcggcttcagacaaagaaatttggcgatggacagaaacaacctctcca
gacgaagtgacggaggagcatgttcgggtcgcttatcgtgtgaatctcccaatttgttca
acgtcgtgcagacgaaactgcaaaggcaatcccaactgcctggtgaatctgggcgagaag
gaatggctaaaggagatcagagatgagcactggtatcagatggatgaccccgaagaagaa
aagagaacaaaggaggacttagtcggattgaaaaatcttggtgcaacgtgttatgtcaac
actttcttacaggatgctcaagagtttagcaagcttctgatctccttgctggagggcaca
ctgaaagagcaacccaatgctcgggatgctcaagagtttagcaagcttctgatctccctg
ctggagggcacactgaaagagcaacccaatgctcgggttaggaacgtcatcgagcagcaa
ttcagcggacaatattcatatgttacaagttcagatggagtgttggctgccattcccgac
gaatctctacaaccaacttcaatatgtggtcacttacaactcctctttgcattgttacag
ttcagcaagagaaggtacattgatccttcaaatttcatcaattgcctgggactggatgca
gctctacagcaggacgctcaagagttcagcaagcttctgatctccttgctggagggcaca
ctgaaagaacaacctaatgctcgggtacggaacgtcatcgagcagcaattcagcggacaa
tattcatatgttacaaggtgcaatcactgtggcaactgttctgagaggccgtctaggttc
tacgagctcgacctcaacatcaaaggtcacaaacagctggaagacagtctgagtgagttt
ctgaaggaggagaagctagagggcgctaatcagtatctttgtgagaagtgtaactgtaag
aggaatgcaacaagatgcattaagcttcagactctgccaccggtactcaatatccaactc
ttaagatttgtgtttgacagacatagtggaacgaagaagaagctgaacaactttctacag
ttccctgaggagattgacatgtccaaacaccttgccaggagagacaacagtgctatgtac
gatctagaggctgtactgatacacagggggcctactgcttactctggtcattacgtggcc
cacatccgtagccatggcgacggaggggtgtggttcaagttcaacgatgaggagattcag
aagatggagggaaagaatctcaagctaggctgtgaggatgagctctccgcaggaaaggaa
ggcaagagacccaaagtaccaaagggaaaccatgcatccaagaatgcctacatgttggtc
tacaaaagaaggtccacagaccagagagagagtcatgtggataattcatcaacagtcacg
agcgttgagaacaacagtgctatgtacgatctagaggctgtactgatacacagggggcct
actgcttactctggtcattacgtggcccacatccgtagccatggtgacggaggggtgtgg
ttcaagttcaacgatgaggagattcagaagatggagggaaagaatctaaagctaggctgt
gaggatgaactctccgcaggaaaggaaggcaagagacccaaagtaccaaagggaaaccat
gcatccaagaatgcttacatgttggtctacaaaagaaggtccacagaccagagaggaaca
gagagtcatgtggataattcaacaaccaccagcaacgttgagagcctaccagactatttg
caggagctgatcgggcgtgataatggagaagcaacggaatggctgagaaatggattacac
tatgaggatgaaactacggggtcaaaggttggcccgatcaacaactacaagtttgaatgc
aaattcaagaatcttgatccacacaaagtaaaggaactcaagaggataagttcaaaagca
gctgacctgttgtttgcaaagtatggtagtgatgggttacagcttagaatgacacagtct
aagatgtgtctagcgtgtgtcaaacagaagtgccaggtcatgaggatccaagcccagctg
gtcgccgatcagaagtttgtcaccgacaacaccaaagcaaaatgtcaaagtgaagatggc
ttttgggtgggtaaagactctctaaagcagtggaagagaatggcagttgagaaggtagaa
tctcagtttgatggagaaggaggagcgacagaaggagaagaggatatggagatcgatgat
gaagaccaggcgttgcccaatggcaaatcctctgcagctggagccactgagggaggagag
aatggagcccctccaaaagaaaacggagagcgtaaagatgagcaggatgaagaggaagag
gaagaggatgaagaaccactggtattcaacgaagaccttctttgcccccatgggaacctg
agcacagacatgagtcagaggagactggtctttgcaccagtgtgggaggtcctccgcaaa
tacttcccggaatcctcagagtttaaagccgacagccagcactgcctgcagtgtcatgtg
aaaaacggagagcagaaagatgagcaggatgaagaggaagaggaagaggatgaagaacca
ctggtattcaacgaagaccttctttgcccccatgggaacctgagcacagacatgagtcag
aggagactggtctttgcaccagtgtgggaggtcctccgcaaatacttcccggaatcctca
gagtttaaagccgacagccagcactgcctgcagtgtcatcttgcagatgcggaggacgca
gagcaagcacagcagagatgtgatcttgccacagaacagaagaaatccctctcacagctc
tttcatggaaggagtagacctgcatggaagaagggagaatccatggaagtgtacgttgcc
ccacttccctttgtggaggcgtggcggagctttctacggcacccggtcaaagcggatctc
ccgaccgacatcgtaaacagttcgttcatctgcgcacacaatggtttgatcttagatcca
agcaccatctcacccattgatgaaacatcaggagttgcgttagtatggccctatgaatgg
gagatactgaaagcaaacttcatcgtagatcaacccattaggatatggaaggtgattgcg
gacgagccttgcttcattacagaaccagatctttgccagacatgctcccaggagagacag
ctagccgagcaccaggcaaggttcacttactccggggtcaagctctacatccgcaagtac
atgccagaggtcggcgagaacgccaaagctgcaatcaacttcctcatggaggctacgtct
ccaggtggatccagcgatcaggagaacaaggatcctgatttccagcagaatgatcctaag
cgaatgaagttggaactagacaacagctcgagctctaggaggagttcacgacacagacga
gtaagaggggagaaagaagtcatggtctcgtcaacaaacacactcaaagaactcaagata
aaggtcatgcatgcattcagcgtagcaccctttgatcagaccctgctgttcagggggaaa
cccctccaggataatgaagcaactctaagtcatctgggggtcacgcccgaggccttaatc
acgctgatcgtagacagccccatatgtgaggacccccttgccatggatgagattgccaga
g

DBGET integrated database retrieval system