KEGG   Strongylocentrotus purpuratus (purple sea urchin): 586365Help
Entry
586365            CDS       T01019                                 

Definition
(RefSeq) uroporphyrinogen-III synthase
  KO
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    586365
Enzymes [BR:spu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     586365
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 341 aa AA seqDB search
MNSLLLRSAQENDTKDKYQEAFQEADVDCVSLSPIGFEFIDLDTLYAHISHPEDHSGLIF
SSPRTVQSVALCLERHDTNDEWNSRLRDEWSKLHAFSVGTSTGGVVRKLGLHPVGEDSGN
AENLCKIILEAVKPGSKPLLYPCGTMRRETIPKTLKKEEWNSRLRDEWSKLPAFSVGTST
GGVVRKLGLHPMGEDSGNAENLCKIILEAVKPGSKPLLYPCGTMRRETIPKTLQKEGILF
KEDVAYQTVPNPDLEQELAKYLQEKGAPFCIVFFSPSGVQYSKEVFDKFKADLHSTKLLA
IGGTTRAAMQEHGYVVAGVAEKPNPTALLQAIQQCQGGTDG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaacagtttgctgctgaggtctgcacaggaaaatgatacaaaggacaagtatcaagag
gcatttcaagaagcagatgtagactgcgtctctctgtcacctatcggctttgagttcatc
gacctggataccctgtatgctcacatatcccatcctgaagaccattctggactcatcttc
tcaagccccaggaccgtccaatcagtcgctctctgccttgagaggcatgatacgaatgat
gaatggaatagcagattgagggatgaatggagtaagctacatgctttcagcgtaggtaca
tcaacaggaggagtagtgaggaaactaggactacatcccgtgggagaagactcaggcaat
gctgaaaatctctgtaaaatcatcttagaagctgtcaaacctggatctaagccactactc
tatccttgcggtacgatgagaagagaaacaattccaaagacattgaagaaggaagaatgg
aatagcagattgagggatgaatggagtaagctacctgccttcagtgtaggtacatcaaca
gggggagtagtgaggaaactaggactacatcccatgggagaagactcaggcaatgctgaa
aatctctgtaaaatcatcttagaagctgtcaagcctggatctaagccactactctatcct
tgcggtacgatgagaagagaaacaattccaaagacattgcagaaggaaggaattcttttt
aaagaagatgtagcctatcaaacagttcccaacccggatctagaacaagagctagccaaa
tacctgcaagaaaagggggcacctttctgcatagttttcttcagtccgtctggggtccag
tattccaaagaggtgtttgacaagttcaaagcagatctacacagtacaaagctcttggct
attggtgggactacacgcgccgcaatgcaggagcatgggtatgtggtagccggtgtagca
gagaagcccaacccaacagcactgcttcaagcaatacaacaatgtcagggaggaacagat
ggatga

DBGET integrated database retrieval system