KEGG   Strongylocentrotus purpuratus (purple sea urchin): 586394Help
Entry
586394            CDS       T01019                                 

Definition
late histone H2B.L4-like
Orthology
K11252  
histone H2B
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 124 aa AA seqDB search
MPAKAVSGKGAKKAGKAKASRATDGKKRRKRRKESYGIYIYKVLKQVHPDTGISSRAMSI
MNSFVNDVFERIAGEASRLAQYNKKSTISSREVQTAVRLLLPGELAKHAVSEGTKAVTKY
TTSK
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgcctgccaaagcagttagcggaaaaggagcgaagaaggccggtaaggcaaaggccagc
cgtgcaactgacggaaagaagaggaggaagcgccgaaaggaaagctacggaatctacatc
tacaaagttctgaagcaggttcatcccgatactggtatctccagccgtgccatgtccatc
atgaacagcttcgtcaacgatgtcttcgagcgcattgccggtgaggcttcccgtcttgcc
caatacaacaagaagtccaccatcagcagccgtgaggtccagaccgctgtcagactcctc
ctccccggagaactcgccaagcacgccgtctctgagggcaccaaggctgtcaccaagtac
accacctccaagtaa

DBGET integrated database retrieval system