KEGG   Strongylocentrotus purpuratus (purple sea urchin): 586525Help
Entry
586525            CDS       T01019                                 

Gene name
pdia4
Definition
protein disulfide isomerase family A, member 4
Orthology
K09582  
protein disulfide-isomerase A4 [EC:5.3.4.1]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:spu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    586525 (pdia4)
Enzymes [BR:spu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     586525 (pdia4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 637 aa AA seqDB search
MMSPKLRIFVLLLAVLSLSIHVVSSQDDEETEESNVVEEIVEEAFHVEEEDDVLVLTTDN
FDDVVNGEDIILVEFYAPWCGHCKTLAPEYAAAALEMKSATPPVSLAKVDATENKELASR
FDVSGYPTLKIFRKGKPFAYDGPREKNGIVQFMKKESDPNWTPPPEAVLTLTSENFDDIV
NEADLILVEFYAPWCGHCKKMAPELETAATALKSNDPPVLIAKVDATAESDLGTRYDVSG
YPTLKIFRKGKESEYKGPRESRGIIQYMQKQVGDSSQLLGSTKALREFLAHQDDVSIVGF
FNSNQDPLYTTYLDAGNGLRDNYRFAHVFDQDSRDSYKINAPSVVVFLPERFRSKYEPWR
HVFTQTEGSVQDLENFYKENDVPLVGQMTKENRERRYTDRPQLVAFFSVDWSFDHRVATE
IYRQKIVEVAKDKEFDELHFAIADEEEFAAEMKQLELDDSGEDINVGIFTADGLRFKLEP
EDDFESDVLREFIRTWQNGDLKPVIKSQPIPKKSKAAVKTIVGKTFEKIVLDKSKDVLIE
FYAPWCGHCKKLDPVYKKLGKKFANTKNLVIAKMDATANDVSNGAYTTTGFPTIYFSKAG
DKDNPIKFEGGERSLEKLSEFIEEHATVAVLQDRDEL
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgatgtccccaaaactgcgcatatttgtccttttgttggctgtattaagcctatcaata
catgtggtgagcagccaagatgacgaagaaactgaagaatcaaatgtagtcgaggaaatc
gtggaggaggcgtttcatgtggaggaagaagatgatgtgcttgtactgactaccgacaat
tttgatgatgtcgtcaacggcgaggacatcattctcgtggaattctacgctccttggtgt
ggtcactgcaagacgctagccccggagtatgctgccgctgcccttgagatgaagtctgcc
actccacctgtgtccctcgccaaggttgacgcaacagagaataaagagctggcctctcgc
tttgacgtctctggttaccctaccttgaagatcttcaggaaagggaaaccttttgcctat
gatggaccaagagaaaagaatggtattgtgcagttcatgaagaaggaatctgatcctaac
tggacaccgcctccagaagctgtccttacgctgaccagtgaaaactttgatgacattgtc
aatgaagccgacctcatcctggtcgaattctatgcaccatggtgtggccactgcaagaaa
atggccccggaattggaaacggctgctacggccctcaagagcaacgacccgcccgtcctc
attgccaaggtagatgctactgctgaaagtgacctgggcaccaggtacgacgtgagtgga
tatcctacactcaagatcttcaggaagggcaaagaatcggaatacaaaggacccagagaa
tcaagaggtatcattcagtacatgcagaaacaagttggtgatagttctcagctccttggc
tctaccaaagctcttcgagagttcctcgcccaccaggacgatgtcagcatcgtaggcttc
ttcaacagtaaccaagatcctctgtacactacatatcttgatgcaggcaacggactgagg
gataactacagatttgctcatgtgtttgatcaggattccagagacagctacaagatcaac
gctccatcggtcgttgtcttcttaccggagcgattcagatccaagtatgaaccatggaga
catgtcttcactcagactgaaggtagtgtccaggacctggagaacttctacaaggagaac
gatgttcctctggtaggccagatgacaaaggaaaaccgagaaaggcgttacacagaccgc
cctcaactggtggctttcttctcagtggactggagtttcgatcacagagttgccaccgag
atctatcgtcagaagatcgtggaggtagccaaggacaaggaatttgacgagcttcacttc
gccatcgccgacgaggaggagttcgcggccgagatgaaacagctggagctcgacgacagc
ggcgaagacatcaacgttggaatcttcactgccgatggactgaggttcaagctggagcct
gaggatgactttgaatccgatgtccttcgcgagttcatcagaacatggcagaatggtgat
ttaaagccagtgatcaagtcccagcccatcccaaagaaatccaaagcagctgtcaagacc
atcgtcggaaaaacatttgagaaaattgtcctggataagtccaaggacgtcctcatcgag
ttttatgcaccgtggtgcggacattgtaaaaagttagatccagtctacaagaaattaggc
aagaaatttgcaaacaccaagaacctcgtcattgccaaaatggacgctactgctaacgac
gtctcaaacggcgcttacacaaccacaggattcccgacaatctatttctccaaagcaggg
gataaggacaaccctatcaagttcgaaggcggagaaaggtcgctagaaaaattgagtgaa
tttatcgaggagcatgcaacggtcgcagtgttgcaggacagagacgagttatag

DBGET integrated database retrieval system