KEGG   Strongylocentrotus purpuratus (purple sea urchin): 586667Help
Entry
586667            CDS       T01019                                 

Definition
guanylate kinase-like
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    586667
Enzymes [BR:spu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     586667
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 187 aa AA seqDB search
MVIDDDGGHDDADGGAADMFRRDTTRNPRPGEQDGVDYHYTTREKMEKAIADGEFLESAQ
FSGNLYGTSKKAVQDVLAAQRICILDIEVQGVMSIKKTDLKPIYIFVKPPSIAVLEERLR
GRQTDSEEAIQKRLTTAIKEMEYINDETSSNSTFIVVNEDKEVTYEQIKGILSTDIVNLR
DIRYKAK
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atggtgatagatgacgatggtggtcatgatgatgctgatggtggtgctgctgatatgttc
cggagagatactactaggaatccaaggccaggggaacaggatggagttgattatcattat
acaactcgggaaaagatggaaaaagccattgcagatggggagtttctagagagtgctcag
ttttcaggcaacctgtatggtacaagtaaaaaggcggttcaggatgtgctagcagcccaa
aggatctgtattctagatattgaagtccaaggggtgatgagcatcaagaagactgacctc
aaaccaatctatatctttgtcaagccaccgagcattgcagtcttggaggaaagacttcga
ggccgacagacagattctgaagaagccattcaaaagagattaacaacagcaataaaggaa
atggaatacatcaatgacgagacctcctccaactcaaccttcatcgtagtgaatgaagac
aaagaggtgacttatgaacaaatcaaggggatcctaagcacggacatcgtcaatctaagg
gacatcagatacaaggcaaagtga

DBGET integrated database retrieval system