KEGG   Strongylocentrotus purpuratus (purple sea urchin): 587252Help
Entry
587252            CDS       T01019                                 

Definition
(RefSeq) laminin subunit gamma-1
  KO
K05635  laminin, gamma 1
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
spu04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:spu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    587252
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Laminin_EGF Laminin_N Laminin_B
Motif
Other DBs
NCBI-GeneID: 587252
NCBI-ProteinID: XP_011670786
Position
Un
AA seq 1455 aa AA seqDB search
MGKSFEITYIRLKFXSPRPESFAIYKRTCQDCPWIPYQYYSGSCRGTYTLPDSEYVSYDD
ETLALCTSEFSDISPLTGGNIAFSTLENRPSARSFDNSAVLQDWVTATDILVMLTRLNTF
GDEVFRVPNVLRSYFFAITDFSIGGRCKCNGHASHCVEAPNDPYNRLVCQCEHNTAGPDC
GECLPLYNDRKWTRATAGNANECMRCNCNFHADRCFFDEELYNRTGSGGHCMECRDETSG
VSCERCRDNYFRTSPDARCQPCNCDQTGSLNQQCDSSGRCQCKVGVGGDKCNQCLPNFYD
FGEGGCRSCECVRAGSVDNNPDCNQGTGLCNCKLHVEGRDCETCKPGFFNLQEADEFGCL
PCFCHGHSSSCSSAPGYDIAYIESNFNSGVDGWKAESRNGDQELLVYNAIRQDIGIATVD
NQPMYFIAPDEYLGNKLFSYGQELSFKLRLGSDDVSLSVEDLVLEGGGRQISAPLVAQGN
PRPGVYPQKFTFKLRAEDDMGWVQRPSAFEFQSLLSNLTAIKIRATYSDRGQGLLDDVRL
VSGRRSVGPQSTRATFVELCSCPTGYVGQFCESCAAGYRRDPYGNGPFTRCIPCECNGHA
DYCDVDTGECICNHNTMGTSCELCQDGFYGNALEGTAYDCTRCPCPGGTNCFVDNLGDVV
CTECPSGYVGNRCDYCADGYYGDPTGIQGQRTACGQCYCNYNIDPNSVGNCDRFTGECLK
CVFDTGGFYCENCLPGFYGNALGSPKGEQCQACNCYVSGSTSNECDQSNGQCSCMPFVTG
RDCSECEAGYWNIDSGRGCEPCYCESTGSTSDQCDIRSGQCPCKPGVDGLRCDQCQYDHY
DYSVEGCTPCECNPQGSLYANCTDDGVCDCQPGVIGDKCDSCEENFYNIALGCIPCPECY
NLVRDNVNVHRDNLDALRDKINQISSNPTVINDTDFEMRLRELEGLLNQTIDDAQRVTGG
TLDISFVISDVAEAMAIINRLKRMLPSAQEYLDNEGWALLEKLRGLTANMSAQDRLMQEI
AREAKQLADNHTEMALMVEETSARALEIAYLALDAARDSGDGGDLEAMVEGVERKYVDAQ
ELFNQASQAADECFERAQRAAEEALRLLTKANMPLSPIDVNSLLDAANDISFRARQLMDE
ANALRRENADLLAQVAEDARTAADLLDQAVAAENLIDLLLAKADNARSIALEAKRKGDET
LQEAKDILRVLQGFNEEIEESKQAADDAKLRIPDIEAMINQANITAHNASDAIAAAEGDA
MKARDYARMAEGNATLASEAARGVRTDAEATMLEAQEQNDRADDLAADAMETMMRLNAIE
GQAEDDGDMADRAQEKANAAKQVTGAALQAAEEALAQLQMIKGELDSAGSIDLERLQDLE
DELLNVNATITYDLRLDDTMDELRAYAMQQAGWISAYQFDLSEIRAEVASLETVRDSLPN
FCPNIVRLEEAPADP
NT seq 4368 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaatcctttgagatcacatacattcggctgaaatttnactcgccgcggccggag
agttttgccatctacaagcgtacgtgtcaggactgtccttggataccctaccagtattac
agcggctcatgtagaggaacctacaccctcccagatagcgaatacgtcagctacgatgat
gaaacattggcgctctgcaccagtgaattcagcgacatctcgccactcacaggaggaaat
attgctttcagtacgctggaaaatagaccgagtgcaaggagttttgataatagtgccgtt
ttacaggattgggtgacagctacagatattctggttatgctgacgagattaaacactttt
ggagatgaagttttcagggtaccaaacgttctacgatcatacttctttgccatcacagat
ttctctattggtggaaggtgtaaatgcaacggtcacgccagccactgcgtggaagcaccc
aacgatccttacaaccgtcttgtatgtcagtgcgaacacaacacagcagggccagactgt
ggcgaatgtctccctctgtacaatgacaggaagtggacgagagccactgctgggaacgca
aatgaatgcatgagatgtaactgcaacttccacgctgaccgttgcttcttcgatgaagag
ctttacaaccgaacaggatccggtggtcactgcatggagtgccgtgatgaaacttctggc
gtcagctgtgagcgttgtcgcgacaactacttcaggacttctccagacgcccgatgccag
ccttgtaactgtgaccaaacaggatcattgaaccagcagtgtgatagctcaggacgatgc
cagtgtaaggtgggagtaggaggagataaatgtaaccagtgtcttcctaacttctatgac
tttggtgaaggtggatgcaggagctgcgagtgtgtgcgtgcaggaagtgtagacaacaac
ccagactgtaaccagggtacaggtctctgcaactgtaaacttcatgttgaaggaagggac
tgcgagacctgcaagcctggtttcttcaaccttcaagaggcagatgagtttggatgcctt
ccctgcttctgtcatggtcattcatcctcttgctcctctgctcctggctatgacattgcc
tacatcgagtccaacttcaattcaggtgtggatggttggaaagccgagagtcgaaatgga
gaccaggaattgcttgtttataatgccatcaggcaggacatcggtatcgcaacagttgac
aaccaacccatgtactttatagccccagatgagtaccttggtaacaagttgttcagctat
ggtcaggagctgagcttcaagctgagactgggcagtgatgatgtgagtctcagcgtggag
gatctcgtcttggagggaggtggcaggcagatctctgctccgctggttgcccagggcaac
ccgcgaccaggtgtctacccgcaaaaatttaccttcaaactgcgagctgaggatgatatg
ggatgggttcaacgaccttcagccttcgagttccagagcctcctttccaacctgactgcc
atcaagatcagagcaacctacagtgatagaggtcaaggactgcttgatgacgtccgtctg
gtcagtggccggcggtcagtcggtccacaaagcaccagggctacattcgtagagctgtgc
agctgcccaaccggctatgtcggtcaattctgtgagtcctgcgctgctggctaccgcagg
gacccctacggcaatggacctttcacacgttgcatcccctgcgagtgcaatggacatgcc
gactactgtgatgttgatactggtgaatgtatctgtaaccacaacaccatgggaacaagc
tgtgaactatgccaggatggtttctatggtaacgcccttgagggcacggcctatgactgc
acacgctgcccctgccccggtggaaccaactgctttgtcgataacctaggtgatgtggtc
tgtaccgagtgcccatcaggctatgttggaaaccgctgtgattactgtgctgatggttat
tacggtgaccctactggcatccaaggccagcgtacagcctgcggacagtgctactgtaac
tacaacattgaccccaattctgtcggcaactgtgataggttcactggagaatgtctcaag
tgtgtctttgacacaggaggattctattgtgagaactgtttacctggtttctatggcaac
gcacttggtagtcccaagggagagcagtgtcaggcctgcaactgctacgtcagtggctcg
actagtaacgaatgtgaccaatccaatggccagtgtagctgcatgcctttcgtgaccggc
cgtgactgcagcgaatgcgaagccggctactggaacatagacagtgggcgtggctgcgag
ccttgctactgtgaaagcaccgggtcaacgtctgaccagtgcgacatccgcagcggtcag
tgtccttgcaagccgggagttgatggtctaaggtgtgaccagtgccagtatgaccattac
gactactctgtagaagggtgtactccatgtgaatgcaatccccaaggatccctgtacgcc
aattgcacagacgatggtgtgtgcgactgccagccaggagtcatcggtgacaagtgtgat
tcctgtgaagagaacttctacaacattgccctgggctgcataccctgccccgagtgctac
aatctggtaagggataacgtgaacgtgcatcgcgacaacctggatgccctgagggacaag
atcaaccagatctccagcaaccccaccgtcatcaacgatacagactttgagatgcgactg
agggagctcgaaggactcctaaatcagaccattgacgacgctcagagagtgacaggtgga
accctcgatatctcctttgtaatttcagatgttgccgaagcgatggctatcatcaatcgt
ctcaagcgtatgttgccttctgcacaggaataccttgacaatgagggttgggcgctgttg
gagaagctgaggggactcacagctaacatgtctgctcaagataggctgatgcaagaaata
gcccgagaggccaagcagctagctgataatcacactgagatggcattgatggtggaggag
acctcagcgagagctctggagattgcctacctggccttggatgctgcacgtgacagtgga
gatggtggggacctggaggctatggtagaaggagtggagcgcaaatatgtcgacgcccaa
gaactgttcaaccaggcttcgcaagccgctgacgaatgctttgagagggcgcaacgggct
gcagaagaggcactccgccttctcaccaaggccaacatgcccctctcgccgattgatgtc
aattctcttcttgatgcagccaatgatataagcttcagagcaaggcagctgatggatgaa
gccaacgctctgaggagagagaacgctgatctcctagcccaggtggcggaggacgccagg
acagccgctgatctgctggaccaagccgtcgcagcggagaacttgattgatctgttgctg
gccaaggccgataatgctcgttccattgccttggaagccaagaggaaaggagatgagaca
cttcaagaagccaaagacatcctcagggtattacaaggattcaacgaggagattgaagag
agcaagcaggcagctgacgatgccaagctcagaatccctgacatcgaggctatgatcaac
caggccaacatcacagcccacaatgcatcagatgccatcgcagctgcagagggcgatgcc
atgaaggcacgagactacgccaggatggcagaaggaaacgcaactttagcttcagaggct
gccaggggggtcaggacagacgccgaggccaccatgcttgaggcacaggaacagaacgac
cgcgctgacgacctcgctgctgatgcaatggaaaccatgatgagactcaatgccatcgag
ggccaggcagaagacgatggggatatggcagatcgggctcaggagaaggcgaacgctgcc
aaacaggtgacgggtgctgccttacaggctgccgaggaagctctagctcaactccagatg
ataaaaggagagctagatagtgctggttctatcgaccttgagagactacaggacctggag
gatgaactcctcaacgtcaacgccaccataacctatgacctcaggctagacgataccatg
gatgaactacgggcctacgccatgcagcaagcaggctggatctcagcgtatcaatttgac
ctcagtgaaatacgagcagaggtcgcatcgctggaaactgtccgggattccttgcctaat
ttctgtcccaacattgttcggcttgaggaagcgcccgcagacccctga

DBGET integrated database retrieval system