KEGG   Strongylocentrotus purpuratus (purple sea urchin): 587252Help
Entry
587252            CDS       T01019                                 

Definition
(RefSeq) laminin subunit gamma-1
  KO
K05635  
laminin, gamma 1
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:spu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    587252
Cell adhesion molecules and their ligands [BR:spu04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    PTPRF, LAR; receptor-type tyrosine-protein phosphatase F [KO:K05695]
     Laminin-1 Extracellular matrix (ECM) components
      587252
 2. Integrin Family
  Beta1 integrins
   VLA-1
    ITGB1; integrin beta 1 [KO:K05719]
      587252
     Laminin-2 Extracellular matrix (ECM) components
      587252
   VLA-2
     Laminin-1 Extracellular matrix (ECM) components
      587252
   VLA-3
      587252
     Laminin-10 Extracellular matrix (ECM) components
      587252
     Laminin-11 Extracellular matrix (ECM) components
      587252
   VLA-6
     Laminin-1 Extracellular matrix (ECM) components
      587252
     Laminin-8 Extracellular matrix (ECM) components
      587252
   VLA-7
     Laminin-1 Extracellular matrix (ECM) components
      587252
  Beta4 integrins
   alpha 6 beta 4
    ITGB4; integrin beta 4 [KO:K06525]
     Laminin-1 Extracellular matrix (ECM) components
      587252
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1455 aa AA seqDB search
MGKSFEITYIRLKFXSPRPESFAIYKRTCQDCPWIPYQYYSGSCRGTYTLPDSEYVSYDD
ETLALCTSEFSDISPLTGGNIAFSTLENRPSARSFDNSAVLQDWVTATDILVMLTRLNTF
GDEVFRVPNVLRSYFFAITDFSIGGRCKCNGHASHCVEAPNDPYNRLVCQCEHNTAGPDC
GECLPLYNDRKWTRATAGNANECMRCNCNFHADRCFFDEELYNRTGSGGHCMECRDETSG
VSCERCRDNYFRTSPDARCQPCNCDQTGSLNQQCDSSGRCQCKVGVGGDKCNQCLPNFYD
FGEGGCRSCECVRAGSVDNNPDCNQGTGLCNCKLHVEGRDCETCKPGFFNLQEADEFGCL
PCFCHGHSSSCSSAPGYDIAYIESNFNSGVDGWKAESRNGDQELLVYNAIRQDIGIATVD
NQPMYFIAPDEYLGNKLFSYGQELSFKLRLGSDDVSLSVEDLVLEGGGRQISAPLVAQGN
PRPGVYPQKFTFKLRAEDDMGWVQRPSAFEFQSLLSNLTAIKIRATYSDRGQGLLDDVRL
VSGRRSVGPQSTRATFVELCSCPTGYVGQFCESCAAGYRRDPYGNGPFTRCIPCECNGHA
DYCDVDTGECICNHNTMGTSCELCQDGFYGNALEGTAYDCTRCPCPGGTNCFVDNLGDVV
CTECPSGYVGNRCDYCADGYYGDPTGIQGQRTACGQCYCNYNIDPNSVGNCDRFTGECLK
CVFDTGGFYCENCLPGFYGNALGSPKGEQCQACNCYVSGSTSNECDQSNGQCSCMPFVTG
RDCSECEAGYWNIDSGRGCEPCYCESTGSTSDQCDIRSGQCPCKPGVDGLRCDQCQYDHY
DYSVEGCTPCECNPQGSLYANCTDDGVCDCQPGVIGDKCDSCEENFYNIALGCIPCPECY
NLVRDNVNVHRDNLDALRDKINQISSNPTVINDTDFEMRLRELEGLLNQTIDDAQRVTGG
TLDISFVISDVAEAMAIINRLKRMLPSAQEYLDNEGWALLEKLRGLTANMSAQDRLMQEI
AREAKQLADNHTEMALMVEETSARALEIAYLALDAARDSGDGGDLEAMVEGVERKYVDAQ
ELFNQASQAADECFERAQRAAEEALRLLTKANMPLSPIDVNSLLDAANDISFRARQLMDE
ANALRRENADLLAQVAEDARTAADLLDQAVAAENLIDLLLAKADNARSIALEAKRKGDET
LQEAKDILRVLQGFNEEIEESKQAADDAKLRIPDIEAMINQANITAHNASDAIAAAEGDA
MKARDYARMAEGNATLASEAARGVRTDAEATMLEAQEQNDRADDLAADAMETMMRLNAIE
GQAEDDGDMADRAQEKANAAKQVTGAALQAAEEALAQLQMIKGELDSAGSIDLERLQDLE
DELLNVNATITYDLRLDDTMDELRAYAMQQAGWISAYQFDLSEIRAEVASLETVRDSLPN
FCPNIVRLEEAPADP
NT seq 4368 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaatcctttgagatcacatacattcggctgaaatttnactcgccgcggccggag
agttttgccatctacaagcgtacgtgtcaggactgtccttggataccctaccagtattac
agcggctcatgtagaggaacctacaccctcccagatagcgaatacgtcagctacgatgat
gaaacattggcgctctgcaccagtgaattcagcgacatctcgccactcacaggaggaaat
attgctttcagtacgctggaaaatagaccgagtgcaaggagttttgataatagtgccgtt
ttacaggattgggtgacagctacagatattctggttatgctgacgagattaaacactttt
ggagatgaagttttcagggtaccaaacgttctacgatcatacttctttgccatcacagat
ttctctattggtggaaggtgtaaatgcaacggtcacgccagccactgcgtggaagcaccc
aacgatccttacaaccgtcttgtatgtcagtgcgaacacaacacagcagggccagactgt
ggcgaatgtctccctctgtacaatgacaggaagtggacgagagccactgctgggaacgca
aatgaatgcatgagatgtaactgcaacttccacgctgaccgttgcttcttcgatgaagag
ctttacaaccgaacaggatccggtggtcactgcatggagtgccgtgatgaaacttctggc
gtcagctgtgagcgttgtcgcgacaactacttcaggacttctccagacgcccgatgccag
ccttgtaactgtgaccaaacaggatcattgaaccagcagtgtgatagctcaggacgatgc
cagtgtaaggtgggagtaggaggagataaatgtaaccagtgtcttcctaacttctatgac
tttggtgaaggtggatgcaggagctgcgagtgtgtgcgtgcaggaagtgtagacaacaac
ccagactgtaaccagggtacaggtctctgcaactgtaaacttcatgttgaaggaagggac
tgcgagacctgcaagcctggtttcttcaaccttcaagaggcagatgagtttggatgcctt
ccctgcttctgtcatggtcattcatcctcttgctcctctgctcctggctatgacattgcc
tacatcgagtccaacttcaattcaggtgtggatggttggaaagccgagagtcgaaatgga
gaccaggaattgcttgtttataatgccatcaggcaggacatcggtatcgcaacagttgac
aaccaacccatgtactttatagccccagatgagtaccttggtaacaagttgttcagctat
ggtcaggagctgagcttcaagctgagactgggcagtgatgatgtgagtctcagcgtggag
gatctcgtcttggagggaggtggcaggcagatctctgctccgctggttgcccagggcaac
ccgcgaccaggtgtctacccgcaaaaatttaccttcaaactgcgagctgaggatgatatg
ggatgggttcaacgaccttcagccttcgagttccagagcctcctttccaacctgactgcc
atcaagatcagagcaacctacagtgatagaggtcaaggactgcttgatgacgtccgtctg
gtcagtggccggcggtcagtcggtccacaaagcaccagggctacattcgtagagctgtgc
agctgcccaaccggctatgtcggtcaattctgtgagtcctgcgctgctggctaccgcagg
gacccctacggcaatggacctttcacacgttgcatcccctgcgagtgcaatggacatgcc
gactactgtgatgttgatactggtgaatgtatctgtaaccacaacaccatgggaacaagc
tgtgaactatgccaggatggtttctatggtaacgcccttgagggcacggcctatgactgc
acacgctgcccctgccccggtggaaccaactgctttgtcgataacctaggtgatgtggtc
tgtaccgagtgcccatcaggctatgttggaaaccgctgtgattactgtgctgatggttat
tacggtgaccctactggcatccaaggccagcgtacagcctgcggacagtgctactgtaac
tacaacattgaccccaattctgtcggcaactgtgataggttcactggagaatgtctcaag
tgtgtctttgacacaggaggattctattgtgagaactgtttacctggtttctatggcaac
gcacttggtagtcccaagggagagcagtgtcaggcctgcaactgctacgtcagtggctcg
actagtaacgaatgtgaccaatccaatggccagtgtagctgcatgcctttcgtgaccggc
cgtgactgcagcgaatgcgaagccggctactggaacatagacagtgggcgtggctgcgag
ccttgctactgtgaaagcaccgggtcaacgtctgaccagtgcgacatccgcagcggtcag
tgtccttgcaagccgggagttgatggtctaaggtgtgaccagtgccagtatgaccattac
gactactctgtagaagggtgtactccatgtgaatgcaatccccaaggatccctgtacgcc
aattgcacagacgatggtgtgtgcgactgccagccaggagtcatcggtgacaagtgtgat
tcctgtgaagagaacttctacaacattgccctgggctgcataccctgccccgagtgctac
aatctggtaagggataacgtgaacgtgcatcgcgacaacctggatgccctgagggacaag
atcaaccagatctccagcaaccccaccgtcatcaacgatacagactttgagatgcgactg
agggagctcgaaggactcctaaatcagaccattgacgacgctcagagagtgacaggtgga
accctcgatatctcctttgtaatttcagatgttgccgaagcgatggctatcatcaatcgt
ctcaagcgtatgttgccttctgcacaggaataccttgacaatgagggttgggcgctgttg
gagaagctgaggggactcacagctaacatgtctgctcaagataggctgatgcaagaaata
gcccgagaggccaagcagctagctgataatcacactgagatggcattgatggtggaggag
acctcagcgagagctctggagattgcctacctggccttggatgctgcacgtgacagtgga
gatggtggggacctggaggctatggtagaaggagtggagcgcaaatatgtcgacgcccaa
gaactgttcaaccaggcttcgcaagccgctgacgaatgctttgagagggcgcaacgggct
gcagaagaggcactccgccttctcaccaaggccaacatgcccctctcgccgattgatgtc
aattctcttcttgatgcagccaatgatataagcttcagagcaaggcagctgatggatgaa
gccaacgctctgaggagagagaacgctgatctcctagcccaggtggcggaggacgccagg
acagccgctgatctgctggaccaagccgtcgcagcggagaacttgattgatctgttgctg
gccaaggccgataatgctcgttccattgccttggaagccaagaggaaaggagatgagaca
cttcaagaagccaaagacatcctcagggtattacaaggattcaacgaggagattgaagag
agcaagcaggcagctgacgatgccaagctcagaatccctgacatcgaggctatgatcaac
caggccaacatcacagcccacaatgcatcagatgccatcgcagctgcagagggcgatgcc
atgaaggcacgagactacgccaggatggcagaaggaaacgcaactttagcttcagaggct
gccaggggggtcaggacagacgccgaggccaccatgcttgaggcacaggaacagaacgac
cgcgctgacgacctcgctgctgatgcaatggaaaccatgatgagactcaatgccatcgag
ggccaggcagaagacgatggggatatggcagatcgggctcaggagaaggcgaacgctgcc
aaacaggtgacgggtgctgccttacaggctgccgaggaagctctagctcaactccagatg
ataaaaggagagctagatagtgctggttctatcgaccttgagagactacaggacctggag
gatgaactcctcaacgtcaacgccaccataacctatgacctcaggctagacgataccatg
gatgaactacgggcctacgccatgcagcaagcaggctggatctcagcgtatcaatttgac
ctcagtgaaatacgagcagaggtcgcatcgctggaaactgtccgggattccttgcctaat
ttctgtcccaacattgttcggcttgaggaagcgcccgcagacccctga

DBGET integrated database retrieval system