KEGG   Strongylocentrotus purpuratus (purple sea urchin): 587317Help
Entry
587317            CDS       T01019                                 

Gene name
FLNA
Definition
filamin A, alpha
Orthology
K04437  
filamin
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 577 aa AA seqDB search
MHCYGGLGVSIEGPSKADINCEDNGDGTCLVTFTPTEPGTYNVNVHYADQLVPGSPFQVA
VQGDSTELPLIRETLVRPTXATPVSTXGSECELTVKIPGTDPLDMTAQVTNPAGRTVDAE
IMDRPDCKYCVKFVPAMEGVHTVSVKNKGLHVPGSPFMFTVGPFGEGGAHKVHAGGPGLE
RGEVKQPAEFTVWTREAGPGKLGITVSGPAKAPINFVDNKDGSYLVSYVPTVPGEYVVDI
KFNDKPIPDSPYKPFVVPPLGEARRCSVSSIQEHGIKINHPASFVIQLNGAKGHLKAKCK
SPSGAEIDCVITEIDEENYAVRFLPTENGIHSVEVFFKDSPIPGSPFRLRVGTVEEVGDP
GHVHAYGEGLERGKTGDKCEFIINTCGAGAGTLGIQIDGPSKVKLDVTEIGEGYKCVYVP
THPGEYMITIKYGGPTHITGSPFMAKITGSAKGGKAGSVETAQVMVETIVKTTTTTGFQA
PVFTSDASKVVSSGMGLKKSFLNKKSQFQVNCSDAGNNMLIVGIAGPKTPCEEIHVKHTF
GQRYTVTYLLKEKGNYVLIVKWGDEHIPGSPFSLQCA
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgcattgttatggaggtcttggtgtatctatcgagggaccaagcaaagcagatattaac
tgtgaggataatggtgatggtacctgccttgtcaccttcacacccactgagccagggaca
tacaatgtcaacgtacactatgctgatcaactagtaccagggagtccgttccaggttgca
gtacaaggagattcaacagagttgcctctgatcagagagaccttggtcagacctactaan
gctactccagtatcaacgnntggtagtgaatgtgaacttacagtcaagatcccaggcacg
gatccactggacatgactgcacaggtgactaacccagctggacgtacagtagatgctgag
atcatggacaggcctgattgcaaatactgtgtcaagtttgttcctgctatggagggtgta
catacagtcagtgtcaagaacaaaggcttgcatgtcccaggaagtccattcatgttcaca
gttggtccattcggcgaaggcggagcacataaggtccatgctggaggtccaggactagag
cgaggagaggtcaaacaaccagctgagttcacagtctggactcgagaagctggtccagga
aagttgggcatcacagtatctggtccagccaaggctccaatcaactttgttgataacaag
gatggttcatacttggtctcctatgtaccaactgtaccaggtgaatacgtggttgatatc
aagttcaatgacaagccaatcccagacagtccttacaagccttttgttgtaccacccctc
ggtgaggctaggagatgcagtgtatccagtatccaggaacatggtatcaagatcaaccat
ccagcctcattcgtgattcaactcaatggtgctaaaggtcatttgaaagcaaagtgtaaa
tcaccatctggagctgagattgattgtgttatcaccgagattgatgaagagaattatgca
gtgcgtttcctaccaactgagaatggaatccacagtgtggaagtcttcttcaaggattct
ccgatcccaggcagtccattcaggcttagggttggtacagtagaggaagtaggagatcca
ggacatgttcatgcttatggagaaggattggagagaggaaagacaggagataagtgtgag
ttcatcatcaacacctgtggagctggagcgggtaccttgggtatccagattgatggtcca
tctaaggtcaagttagatgtgactgagattggtgaaggatacaagtgtgtctacgtccca
acgcatcctggagaatacatgattactatcaaatatggtggtcccactcatatcactggc
agtcccttcatggctaagattactggatctgcaaagggaggcaaggcaggcagcgttgaa
acagcccaagtcatggtagaaaccatcgtcaagacaaccaccacaacaggtttccaagct
ccagtctttacttccgatgctagcaaggttgtttctagtggaatgggtctcaagaaatca
ttcttgaacaagaagagtcagttccaagtcaactgctcagatgcaggtaataacatgttg
attgtaggtatcgctggtcccaaaacaccttgtgaagagattcatgtcaaacacaccttc
ggtcagcgttacacagtaacctacctactcaaagagaagggtaactatgtcttgatagtg
aaatggggagatgagcacataccaggcagtccattcagccttcaatgtgcttag

DBGET integrated database retrieval system