KEGG   Strongylocentrotus purpuratus (purple sea urchin): 587317Help
Entry
587317            CDS       T01019                                 

Gene name
FLNA
Definition
(RefSeq) filamin-A
  KO
K04437  
filamin
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Cytoskeleton proteins [BR:spu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     587317 (FLNA)
  Intermediate filaments
   Intermediate filament-binding proteins
    587317 (FLNA)
Exosome [BR:spu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   587317 (FLNA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 578 aa AA seqDB search
LVAGYGGLGVSIEGPSKADINCEDNGDGTCLVTFTPTEPGTYNVNVHYADQLVPGSPFQV
AVQGDSTELPLIRETLVRPTXATPVSTXGSECELTVKIPGTDPLDMTAQVTNPAGRTVDA
EIMDRPDCKYCVKFVPAMEGVHTVSVKNKGLHVPGSPFMFTVGPFGEGGAHKVHAGGPGL
ERGEVKQPAEFTVWTREAGPGKLGITVSGPAKAPINFVDNKDGSYLVSYVPTVPGEYVVD
IKFNDKPIPDSPYKPFVVPPLGEARRCSVSSIQEHGIKINHPASFVIQLNGAKGHLKAKC
KSPSGAEIDCVITEIDEENYAVRFLPTENGIHSVEVFFKDSPIPGSPFRLRVGTVEEVGD
PGHVHAYGEGLERGKTGDKCEFIINTCGAGAGTLGIQIDGPSKVKLDVTEIGEGYKCVYV
PTHPGEYMITIKYGGPTHITGSPFMAKITGSAKGGKAGSVETAQVMVETIVKTTTTTGFQ
APVFTSDASKVVSSGMGLKKSFLNKKSQFQVNCSDAGNNMLIVGIAGPKTPCEEIHVKHT
FGQRYTVTYLLKEKGNYVLIVKWGDEHIPGSPFSLQCA
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
ctggtggcaggttatggaggtcttggtgtatctatcgagggaccaagcaaagcagatatt
aactgtgaggataatggtgatggtacctgccttgtcaccttcacacccactgagccaggg
acatacaatgtcaacgtacactatgctgatcaactagtaccagggagtccgttccaggtt
gcagtacaaggagattcaacagagttgcctctgatcagagagaccttggtcagacctact
aangctactccagtatcaacgnntggtagtgaatgtgaacttacagtcaagatcccaggc
acggatccactggacatgactgcacaggtgactaacccagctggacgtacagtagatgct
gagatcatggacaggcctgattgcaaatactgtgtcaagtttgttcctgctatggagggt
gtacatacagtcagtgtcaagaacaaaggcttgcatgtcccaggaagtccattcatgttc
acagttggtccattcggcgaaggcggagcacataaggtccatgctggaggtccaggacta
gagcgaggagaggtcaaacaaccagctgagttcacagtctggactcgagaagctggtcca
ggaaagttgggcatcacagtatctggtccagccaaggctccaatcaactttgttgataac
aaggatggttcatacttggtctcctatgtaccaactgtaccaggtgaatacgtggttgat
atcaagttcaatgacaagccaatcccagacagtccttacaagccttttgttgtaccaccc
ctcggtgaggctaggagatgcagtgtatccagtatccaggaacatggtatcaagatcaac
catccagcctcattcgtgattcaactcaatggtgctaaaggtcatttgaaagcaaagtgt
aaatcaccatctggagctgagattgattgtgttatcaccgagattgatgaagagaattat
gcagtgcgtttcctaccaactgagaatggaatccacagtgtggaagtcttcttcaaggat
tctccgatcccaggcagtccattcaggcttagggttggtacagtagaggaagtaggagat
ccaggacatgttcatgcttatggagaaggattggagagaggaaagacaggagataagtgt
gagttcatcatcaacacctgtggagctggagcgggtaccttgggtatccagattgatggt
ccatctaaggtcaagttagatgtgactgagattggtgaaggatacaagtgtgtctacgtc
ccaacgcatcctggagaatacatgattactatcaaatatggtggtcccactcatatcact
ggcagtcccttcatggctaagattactggatctgcaaagggaggcaaggcaggcagcgtt
gaaacagcccaagtcatggtagaaaccatcgtcaagacaaccaccacaacaggtttccaa
gctccagtctttacttccgatgctagcaaggttgtttctagtggaatgggtctcaagaaa
tcattcttgaacaagaagagtcagttccaagtcaactgctcagatgcaggtaataacatg
ttgattgtaggtatcgctggtcccaaaacaccttgtgaagagattcatgtcaaacacacc
ttcggtcagcgttacacagtaacctacctactcaaagagaagggtaactatgtcttgata
gtgaaatggggagatgagcacataccaggcagtccattcagccttcaatgtgcttag

DBGET integrated database retrieval system