KEGG   Strongylocentrotus purpuratus (purple sea urchin): 587317Help
Entry
587317            CDS       T01019                                 

Gene name
FLNA
Definition
filamin A, alpha
Orthology
K04437  
filamin
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Exosome [BR:spu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   587317 (FLNA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 577 aa AA seqDB search
MHCYGGLGVSIEGPSKADINCEDNGDGTCLVTFTPTEPGTYNVNVHYADQLVPGSPFQVA
VQGDSTELPLIRETLVRPTXATPVSTXGSECELTVKIPGTDPLDMTAQVTNPAGRTVDAE
IMDRPDCKYCVKFVPAMEGVHTVSVKNKGLHVPGSPFMFTVGPFGEGGAHKVHAGGPGLE
RGEVKQPAEFTVWTREAGPGKLGITVSGPAKAPINFVDNKDGSYLVSYVPTVPGEYVVDI
KFNDKPIPDSPYKPFVVPPLGEARRCSVSSIQEHGIKINHPASFVIQLNGAKGHLKAKCK
SPSGAEIDCVITEIDEENYAVRFLPTENGIHSVEVFFKDSPIPGSPFRLRVGTVEEVGDP
GHVHAYGEGLERGKTGDKCEFIINTCGAGAGTLGIQIDGPSKVKLDVTEIGEGYKCVYVP
THPGEYMITIKYGGPTHITGSPFMAKITGSAKGGKAGSVETAQVMVETIVKTTTTTGFQA
PVFTSDASKVVSSGMGLKKSFLNKKSQFQVNCSDAGNNMLIVGIAGPKTPCEEIHVKHTF
GQRYTVTYLLKEKGNYVLIVKWGDEHIPGSPFSLQCA
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgcattgttatggaggtcttggtgtatctatcgagggaccaagcaaagcagatattaac
tgtgaggataatggtgatggtacctgccttgtcaccttcacacccactgagccagggaca
tacaatgtcaacgtacactatgctgatcaactagtaccagggagtccgttccaggttgca
gtacaaggagattcaacagagttgcctctgatcagagagaccttggtcagacctactaan
gctactccagtatcaacgnntggtagtgaatgtgaacttacagtcaagatcccaggcacg
gatccactggacatgactgcacaggtgactaacccagctggacgtacagtagatgctgag
atcatggacaggcctgattgcaaatactgtgtcaagtttgttcctgctatggagggtgta
catacagtcagtgtcaagaacaaaggcttgcatgtcccaggaagtccattcatgttcaca
gttggtccattcggcgaaggcggagcacataaggtccatgctggaggtccaggactagag
cgaggagaggtcaaacaaccagctgagttcacagtctggactcgagaagctggtccagga
aagttgggcatcacagtatctggtccagccaaggctccaatcaactttgttgataacaag
gatggttcatacttggtctcctatgtaccaactgtaccaggtgaatacgtggttgatatc
aagttcaatgacaagccaatcccagacagtccttacaagccttttgttgtaccacccctc
ggtgaggctaggagatgcagtgtatccagtatccaggaacatggtatcaagatcaaccat
ccagcctcattcgtgattcaactcaatggtgctaaaggtcatttgaaagcaaagtgtaaa
tcaccatctggagctgagattgattgtgttatcaccgagattgatgaagagaattatgca
gtgcgtttcctaccaactgagaatggaatccacagtgtggaagtcttcttcaaggattct
ccgatcccaggcagtccattcaggcttagggttggtacagtagaggaagtaggagatcca
ggacatgttcatgcttatggagaaggattggagagaggaaagacaggagataagtgtgag
ttcatcatcaacacctgtggagctggagcgggtaccttgggtatccagattgatggtcca
tctaaggtcaagttagatgtgactgagattggtgaaggatacaagtgtgtctacgtccca
acgcatcctggagaatacatgattactatcaaatatggtggtcccactcatatcactggc
agtcccttcatggctaagattactggatctgcaaagggaggcaaggcaggcagcgttgaa
acagcccaagtcatggtagaaaccatcgtcaagacaaccaccacaacaggtttccaagct
ccagtctttacttccgatgctagcaaggttgtttctagtggaatgggtctcaagaaatca
ttcttgaacaagaagagtcagttccaagtcaactgctcagatgcaggtaataacatgttg
attgtaggtatcgctggtcccaaaacaccttgtgaagagattcatgtcaaacacaccttc
ggtcagcgttacacagtaacctacctactcaaagagaagggtaactatgtcttgatagtg
aaatggggagatgagcacataccaggcagtccattcagccttcaatgtgcttag

DBGET integrated database retrieval system