KEGG   Strongylocentrotus purpuratus (purple sea urchin): 587330Help
Entry
587330            CDS       T01019                                 

Definition
(RefSeq) mitogen-activated protein kinase 6
  KO
K06855  
mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Enzymes [BR:spu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     587330
Protein kinases [BR:spu01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   587330
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 781 aa AA seqDB search
MSVLLKNSRHPFQKVISVYVLWLNSMARLDSPTEGLYLPHGIGSRFCDLRPLGYGSSGTV
FSAVDSECDKSVAIKRVSLTDKKSCKSALREIRILRKLQHENIVKIYDVIFDGNSDNSED
EDISIPSELRTLCIVQELVDADLRVVMEQQRISNEHVRLFAYQLLRGLKYLHSANVLHRD
LKPENVLINQEDLVLKIGDFGMARIVDPDYSHKGYLTQNVSTQWYRSPELVLQPTDYTKA
IDLWSAGCILAEMVTGKPLFPGDHDLELMMLVLDSVQLNDRDLNEILCTLPSKLLKNYNG
YPRHPLKEVLCNLDCHALDLLLAMLTFDPSERITAEEALRSPYFKVYSCIRDEAKATHPF
HIENEIDDLPPIVIKKIILEECLERTDVDVSFGGRTANVCDESEDNSSSSRDLVQSSTEG
SLGSFSDEEAKEACIDNAFLNRMVSVGNNRSDDSEKNETEESEKSDDEEKEAKWEDFKEM
MSMDPNNLEDREEREGDAIEKGSVESDNEGSEKSEADDQISEKRNNQDDEEKRGSKEDLL
MEKFEEDNTGDNNKKEEEKTEEGAMSKTARKESLVFMDYEAVEKAFGDKLQKEKLNEQLS
NREFEDGSVRKKESSENKELDLTDTLDILKKQAKSKGKTLDDCLELGTLRLSETSPTPKN
TDVVLDKQLYVHKESKGNQEFNDKSEFVEQIRTDNTSVSNERMGELQKVRCNTQTEKKQG
RPKKPDLKEVLYVDIPKASASISPRSSPRGPGKETTTRRNSLSPRERSVRPKKKDWFYSK
H
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttttattaaagaattcccggcacccattccagaaggttatttctgtctacgta
ttgtggttgaacagtatggctaggttagattctcctaccgaaggtctatacctgccccac
ggcattggatccagattctgtgaccttcgacctctaggatacggcagtagcggaacggtc
ttctctgctgtggacagcgagtgcgacaagagcgtggccatcaagcgcgtctcgctcacc
gacaagaaaagctgcaaatcggccctgagggaaatccgaatcctccggaagcttcagcat
gagaacatcgtcaagatatacgatgtgatcttcgatggcaattcagataactctgaggat
gaggatatcagtatcccgtctgagctcaggacgctgtgtatcgtacaggagttggtggat
gcagatctaagggtggtgatggaacaacagcgtatcagcaatgaacatgtccggctattt
gcatatcagcttttacgggggttgaagtacctgcacagtgccaacgtcttgcatagggac
ctcaagccagagaatgtcttaatcaatcaggaagatttggtgctcaagattggggatttt
ggaatggcaagaattgtggatccagactattcacacaaaggctacctcacacagaatgtg
tccacccagtggtaccgttcaccggagctggttctccaacccaccgactacaccaaggcc
attgacctctggtctgctggctgcatcctggcagagatggtcactggcaagcccctgttc
cctggagaccatgacctggaactgatgatgctggtcctggactcggtgcagctcaacgac
agggatctcaatgaaatcctgtgtacgcttccgagcaaactgctgaagaactacaacggc
tatcctagacatcccctcaaagaggtgctctgtaacttagactgtcatgctcttgattta
ctgcttgccatgctgacctttgacccttcagagagaatcacagccgaagaggcactgaga
agtccatatttcaaagtgtattcatgcatcagggatgaagccaaagcaacgcatcctttc
cacattgaaaatgaaatagatgatctaccacctattgttattaagaaaattatccttgaa
gaatgtctggagaggacagatgttgatgtctcgttcggtggccgtaccgcgaacgtgtgt
gatgagagcgaagacaattccagcagcagtagagaccttgtgcagtccagcaccgaggga
agtttgggctcattcagtgatgaagaggcgaaggaagcttgcatagacaatgcattcttg
aataggatggtcagtgtgggcaacaacaggagtgacgatagtgagaagaacgagacggag
gagagcgagaagtcggatgatgaggagaaggaggctaagtgggaggatttcaaggagatg
atgtccatggatcccaacaacctggaggatagggaggagcgagagggagatgccatcgaa
aagggttcagtcgagtctgataacgaaggcagtgagaagtcagaagcagatgatcagatc
agcgagaagcgcaacaatcaagatgatgaagagaagagaggatcgaaggaagatcttctg
atggagaaatttgaagaggataacacaggagacaacaacaagaaagaagaagagaaaaca
gaggaaggagccatgtccaaaacagcgaggaaagagagccttgtgtttatggattatgag
gcagtagagaaagcctttggggataagttgcagaaggaaaagctgaatgaacagctgtcc
aacagagagtttgaagatggaagcgtcaggaagaaggaaagcagcgagaacaaagagcta
gatttaactgacaccttagatatcttaaagaaacaggcgaagagtaaaggaaagacactg
gatgattgtctagagcttggcacgctgaggctgagtgagacgtctccaaccccgaagaat
acagatgtggtgcttgacaagcaactttacgtccataaagaatccaaaggtaaccaggag
ttcaatgacaagagtgaatttgttgagcaaataaggacagacaacacgtcggtatccaac
gaaagaatgggtgaacttcaaaaagtgcgatgcaacacgcagactgagaagaaacaaggt
aggccaaagaaacctgatctgaaggaagtcctctatgtggacatccccaaggcttctgct
agtatctcacctaggagttcccccaggggaccgggtaaggagacgacaacacgcaggaac
agtttgtctccaagggaaagaagtgtaagaccaaagaagaaagattggttttactcaaag
cattaa

DBGET integrated database retrieval system