KEGG   Strongylocentrotus purpuratus (purple sea urchin): 587412Help
Entry
587412            CDS       T01019                                 

Gene name
plcb4
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4
  KO
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Wnt signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    587412 (plcb4)
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    587412 (plcb4)
   04070 Phosphatidylinositol signaling system
    587412 (plcb4)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    587412 (plcb4)
Enzymes [BR:spu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     587412 (plcb4)
Membrane trafficking [BR:spu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    587412 (plcb4)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    587412 (plcb4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 1255 aa AA seqDB search
MAKQYVFQWQVNVPEPLKNGAMFDRYEDGDSGSVEQSCLFKVDEYGFFIYYKSEGREGQV
LELSQINDVRKGIAPKDVGYLAKVGSILDPFGRGNIEDRTITICSGLDFVNINYMHMVAS
TPEIAQVWFDGLLTITHNVKANNVCPMQSLKKHWMKICFQVNPNGRIPVRNLTRTFASGK
TEKIVFKSLDELGLPSGKMEEIDPADFPFEKFYELYHKICPRTDIELLFQDIGRNDIEGL
SVEKLIEFLNDKQRDPRLNEILFPMYDRERVLQIIDTYEKYPEMIKKELLSSDGLCRYLM
SDENAPVFLDRLELYQDMEQPLSHYLINSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCV
ELDCWDGRSEDQEPIITHGLAMCTDIQFKEVIQAIRDTAFVTSDFPVILSFENHCSKPQQ
LKLARYCEEVLGEFLLTEKLDDHLLEASVPLPSPNKLKRKILIKNKRLKPDVEQRQLELM
RLRPELLEVNVEDEVEECESESESEDSDDMPPQVVAAHLLRKVKLPPGEEVHPDLKVGFS
SRQNRETGYHDGAVSPPGNTDAHPEFKFPSKDSIGSISGSSIAAEDEIKLKHNLSVKMNA
KKLVLQGELLSQEDEAAVVAQYRYTGATTNIHACLSRLVNYAQPVKFQGFDVAEERNLHF
NMSSFNESVGLGYIKTQCIEFVNYNKRQMSRIYPQGRRYDSSNYMPQIFWNAGCQMVALN
FQSPDIGMQLNQGKFEYNGGCGYLLKPDFMRRPDRTFDPFSESPVDGVIAATCSVQVISG
QFLSDKKVGTYVEVDMYGLPTDTIRREHRTRTVPNNGLNPVYNEEPFVFRKVVLPDLAVL
RIAVYEEGGKLIGQRILPLDGLQAGYRHISLRTEGNFPLSLPTVFCCIQLKTYVPDGLTQ
FVDALSDPQLYLSQAEKRAKQLICMGIEENEISEVPTVNNKKRPTVRHPTTPTNTAPNIG
GFSPGGPTHNQSKNFITRCQDGKDKQKGFQPITADSLRKERAYQKLLKKQQKEQDSLNKR
HSKERATLQKTHYSTVNKMEACHDREKLTREKSLEKAIKKKGESNCSDLKIETECHVQSL
VNEHKARVRDVVSDQSKEFAEMVNRQQAEERSLKDNHIQQRCDLLKKLMLSTQEEQLQLL
AARNDREMKELKSNQAKDSMESTKSVSHDKSIKNKAERDRRVRELQSNNTKKFLEERKRL
KMKQDKEKEEVQQEHSKQMEKLRKEIDKMVEAEKVVLDGAANKVHLAARPDSSTV
NT seq 3768 nt NT seq  +upstreamnt  +downstreamnt
atggctaagcaatatgtatttcagtggcaagtcaatgttccggaaccccttaaaaatggg
gccatgttcgacagatacgaagatggggattctgggtcagttgaacagagttgcctcttc
aaagttgatgaatatggatttttcatctactataagagcgaaggcagggaggggcaggtg
ttagaattatcccagatcaatgatgtacgaaagggtattgcaccaaaggatgtaggatac
ttggccaaagttggttccatcttggacccgtttggtagagggaacattgaagaccgcacc
atcaccatctgcagtggcttggactttgtcaatatcaactacatgcacatggttgccagc
acacctgaaatagcacaggtatggtttgacggattactgacgataactcacaatgtcaaa
gctaacaatgtgtgtccaatgcagagtttaaagaaacactggatgaaaatttgctttcaa
gtcaaccccaatggcagaattccagtacggaatctcacaagaacctttgcatcgggcaag
actgagaagattgtcttcaagtcgctagatgagctaggacttccctcaggcaagatggaa
gaaatagatcctgcagacttcccatttgaaaagttctatgagttgtaccacaagatctgt
ccaaggacagacatagagctactcttccaagatataggacgaaatgacatagagggactg
tcagtggagaagctgattgaattcttgaacgacaagcagagggatcctagactcaatgag
attctctttccaatgtatgacagagagagggttctacaaatcattgacacctatgagaaa
tatccagagatgattaagaaagaacttctatcgtctgatggactttgtcgatacctgatg
tctgatgagaacgcacccgtgttcctggaccgattggagttataccaagacatggaacag
cccctttcacattacctcattaattcgtctcataatacatacttaaccgggagacagttt
ggaggcaaatcatctgttgagatgtacagacaggttctactggcgggatgcagatgtgtt
gagttagactgttgggacggaagaagtgaagaccaagaaccaatcataacccatggactt
gcaatgtgtactgatatacaattcaaggaagtgattcaagctatcagagacactgcattt
gtgacgtcagacttcccagtgatactgtcctttgagaaccattgtagtaaacctcaacag
ctcaaactagcaagatactgtgaagaggttcttggagaattcctgctcaccgaaaagttg
gatgatcatctgttggaggccagtgttcctcttccatcacctaataaattaaagaggaag
attcttataaaaaataagaggctgaaaccagatgtagaacagagacaacttgagttgatg
cggttacgaccagaactgcttgaagtcaacgtagaagatgaagtagaagaatgcgaatca
gagagtgaatcagaagacagtgatgacatgccaccccaagttgtagctgcccacctgctt
aggaaagtcaagctgcctcctggggaagaagttcaccctgatttaaaagttggtttcagt
agcagacaaaatagagaaacagggtaccatgatggtgctgtttccccaccaggcaataca
gatgctcatcccgagttcaagttcccgtctaaagactccatcggaagcatcagcggaagc
agcatcgcggctgaggatgagatcaaactcaaacataacctcagtgtcaagatgaatgca
aagaagcttgttttgcaaggagagctattatcacaagaagatgaagcagcagtagtagcc
cagtatcgttacaccggagctacaaccaacatccatgcttgcctctcaagactcgtcaac
tatgcacaacctgtcaaattccagggattcgatgtagctgaagagagaaatcttcacttc
aacatgtcatcattcaatgagtcggtgggcttaggatatatcaagacacagtgtattgaa
tttgtcaattacaataaacgtcaaatgagtaggatctaccctcaaggaagaaggtatgac
tcaagcaactacatgccgcagatcttctggaatgctggatgtcagatggttgcactcaat
ttccagtcacctgacattggcatgcagctcaaccagggaaagtttgaatacaatgggggc
tgcgggtatttactcaagccagatttcatgaggagaccggacaggacatttgatcccttc
tcagagtcccctgtggatggtgtgattgcagcaacgtgctcagtgcaggtgatatcagga
cagttcttgtcagacaagaaagtgggcacgtatgttgaagttgatatgtatggtcttcct
acggacacaataaggagagaacacaggacaaggacggtccctaataacggactcaatcct
gtctacaatgaagaaccctttgtctttagaaaagttgtactaccagatcttgctgtattg
aggatagcggtgtatgaggaaggaggtaaactaataggacagagaatcttgccattggat
ggattacaagcaggttatagacatatatcactgagaacagaaggtaacttccccttatca
ctgcctactgtcttctgctgtattcaactcaaaacatatgtaccagatggcttaacacag
tttgtagatgctctatcagatcctcagttgtatctatcacaggcagagaaaagagctaag
cagctcatatgcatgggcattgaagagaatgagattagtgaggtacccacagtgaataac
aagaagagaccaacggtacgacatccgacaacccctaccaacacagcaccaaacattggt
ggattctcaccgggtggacctactcataaccagagtaagaacttcatcactaggtgtcaa
gatggcaaagacaaacaaaaaggatttcagcccataacagcagacagcctaaggaaagaa
agagcatatcagaaactgctgaagaaacaacaaaaagagcaagattcattgaacaagaga
cattccaaagagagggccacattacagaagacacactactcaacggtcaacaagatggag
gcttgtcatgatagagagaaactcaccagagaaaagagtctagaaaaggccatcaagaag
aaaggggaaagcaactgctcagatctgaagatagaaactgagtgccatgtacaatcatta
gtcaatgaacacaaggcaagggtaagagacgtagtatcggaccagagcaaggagtttgct
gagatggtgaatcgtcagcaagcagaggagaggagtttgaaagataaccacatccagcag
agatgtgaccttctcaagaaactcatgctcagtactcaagaggaacaattacagctccta
gcggctagaaatgacagagaaatgaaggagctcaagtcaaatcaagccaaggattccatg
gaatcaaccaaaagtgttagccatgacaaaagtatcaagaacaaagcagagagagacagg
agagtaagggagcttcaaagtaataacacaaagaaattcttggaagagaggaaaaggctg
aaaatgaaacaagacaaagagaaagaggaagtacaacaggaacatagcaaacaaatggag
aaactacgcaaagaaattgacaagatggttgaagccgagaaggtagtgttagatggagca
gctaataaggtccaccttgctgcaagacctgactcctctacagtctga

DBGET integrated database retrieval system