KEGG   Strongylocentrotus purpuratus (purple sea urchin): 587412Help
Entry
587412            CDS       T01019                                 

Gene name
plcb4
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4
  KO
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Wnt signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    587412 (plcb4)
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    587412 (plcb4)
   04070 Phosphatidylinositol signaling system
    587412 (plcb4)
Enzymes [BR:spu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     587412 (plcb4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1255 aa AA seqDB search
MAKQYVFQWQVNVPEPLKNGAMFDRYEDGDSGSVEQSCLFKVDEYGFFIYYKSEGREGQV
LELSQINDVRKGIAPKDVGYLAKVGSILDPFGRGNIEDRTITICSGLDFVNINYMHMVAS
TPEIAQVWFDGLLTITHNVKANNVCPMQSLKKHWMKICFQVNPNGRIPVRNLTRTFASGK
TEKIVFKSLDELGLPSGKMEEIDPADFPFEKFYELYHKICPRTDIELLFQDIGRNDIEGL
SVEKLIEFLNDKQRDPRLNEILFPMYDRERVLQIIDTYEKYPEMIKKELLSSDGLCRYLM
SDENAPVFLDRLELYQDMEQPLSHYLINSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCV
ELDCWDGRSEDQEPIITHGLAMCTDIQFKEVIQAIRDTAFVTSDFPVILSFENHCSKPQQ
LKLARYCEEVLGEFLLTEKLDDHLLEASVPLPSPNKLKRKILIKNKRLKPDVEQRQLELM
RLRPELLEVNVEDEVEECESESESEDSDDMPPQVVAAHLLRKVKLPPGEEVHPDLKVGFS
SRQNRETGYHDGAVSPPGNTDAHPEFKFPSKDSIGSISGSSIAAEDEIKLKHNLSVKMNA
KKLVLQGELLSQEDEAAVVAQYRYTGATTNIHACLSRLVNYAQPVKFQGFDVAEERNLHF
NMSSFNESVGLGYIKTQCIEFVNYNKRQMSRIYPQGRRYDSSNYMPQIFWNAGCQMVALN
FQSPDIGMQLNQGKFEYNGGCGYLLKPDFMRRPDRTFDPFSESPVDGVIAATCSVQVISG
QFLSDKKVGTYVEVDMYGLPTDTIRREHRTRTVPNNGLNPVYNEEPFVFRKVVLPDLAVL
RIAVYEEGGKLIGQRILPLDGLQAGYRHISLRTEGNFPLSLPTVFCCIQLKTYVPDGLTQ
FVDALSDPQLYLSQAEKRAKQLICMGIEENEISEVPTVNNKKRPTVRHPTTPTNTAPNIG
GFSPGGPTHNQSKNFITRCQDGKDKQKGFQPITADSLRKERAYQKLLKKQQKEQDSLNKR
HSKERATLQKTHYSTVNKMEACHDREKLTREKSLEKAIKKKGESNCSDLKIETECHVQSL
VNEHKARVRDVVSDQSKEFAEMVNRQQAEERSLKDNHIQQRCDLLKKLMLSTQEEQLQLL
AARNDREMKELKSNQAKDSMESTKSVSHDKSIKNKAERDRRVRELQSNNTKKFLEERKRL
KMKQDKEKEEVQQEHSKQMEKLRKEIDKMVEAEKVVLDGAANKVHLAARPDSSTV
NT seq 3768 nt NT seq  +upstreamnt  +downstreamnt
atggctaagcaatatgtatttcagtggcaagtcaatgttccggaaccccttaaaaatggg
gccatgttcgacagatacgaagatggggattctgggtcagttgaacagagttgcctcttc
aaagttgatgaatatggatttttcatctactataagagcgaaggcagggaggggcaggtg
ttagaattatcccagatcaatgatgtacgaaagggtattgcaccaaaggatgtaggatac
ttggccaaagttggttccatcttggacccgtttggtagagggaacattgaagaccgcacc
atcaccatctgcagtggcttggactttgtcaatatcaactacatgcacatggttgccagc
acacctgaaatagcacaggtatggtttgacggattactgacgataactcacaatgtcaaa
gctaacaatgtgtgtccaatgcagagtttaaagaaacactggatgaaaatttgctttcaa
gtcaaccccaatggcagaattccagtacggaatctcacaagaacctttgcatcgggcaag
actgagaagattgtcttcaagtcgctagatgagctaggacttccctcaggcaagatggaa
gaaatagatcctgcagacttcccatttgaaaagttctatgagttgtaccacaagatctgt
ccaaggacagacatagagctactcttccaagatataggacgaaatgacatagagggactg
tcagtggagaagctgattgaattcttgaacgacaagcagagggatcctagactcaatgag
attctctttccaatgtatgacagagagagggttctacaaatcattgacacctatgagaaa
tatccagagatgattaagaaagaacttctatcgtctgatggactttgtcgatacctgatg
tctgatgagaacgcacccgtgttcctggaccgattggagttataccaagacatggaacag
cccctttcacattacctcattaattcgtctcataatacatacttaaccgggagacagttt
ggaggcaaatcatctgttgagatgtacagacaggttctactggcgggatgcagatgtgtt
gagttagactgttgggacggaagaagtgaagaccaagaaccaatcataacccatggactt
gcaatgtgtactgatatacaattcaaggaagtgattcaagctatcagagacactgcattt
gtgacgtcagacttcccagtgatactgtcctttgagaaccattgtagtaaacctcaacag
ctcaaactagcaagatactgtgaagaggttcttggagaattcctgctcaccgaaaagttg
gatgatcatctgttggaggccagtgttcctcttccatcacctaataaattaaagaggaag
attcttataaaaaataagaggctgaaaccagatgtagaacagagacaacttgagttgatg
cggttacgaccagaactgcttgaagtcaacgtagaagatgaagtagaagaatgcgaatca
gagagtgaatcagaagacagtgatgacatgccaccccaagttgtagctgcccacctgctt
aggaaagtcaagctgcctcctggggaagaagttcaccctgatttaaaagttggtttcagt
agcagacaaaatagagaaacagggtaccatgatggtgctgtttccccaccaggcaataca
gatgctcatcccgagttcaagttcccgtctaaagactccatcggaagcatcagcggaagc
agcatcgcggctgaggatgagatcaaactcaaacataacctcagtgtcaagatgaatgca
aagaagcttgttttgcaaggagagctattatcacaagaagatgaagcagcagtagtagcc
cagtatcgttacaccggagctacaaccaacatccatgcttgcctctcaagactcgtcaac
tatgcacaacctgtcaaattccagggattcgatgtagctgaagagagaaatcttcacttc
aacatgtcatcattcaatgagtcggtgggcttaggatatatcaagacacagtgtattgaa
tttgtcaattacaataaacgtcaaatgagtaggatctaccctcaaggaagaaggtatgac
tcaagcaactacatgccgcagatcttctggaatgctggatgtcagatggttgcactcaat
ttccagtcacctgacattggcatgcagctcaaccagggaaagtttgaatacaatgggggc
tgcgggtatttactcaagccagatttcatgaggagaccggacaggacatttgatcccttc
tcagagtcccctgtggatggtgtgattgcagcaacgtgctcagtgcaggtgatatcagga
cagttcttgtcagacaagaaagtgggcacgtatgttgaagttgatatgtatggtcttcct
acggacacaataaggagagaacacaggacaaggacggtccctaataacggactcaatcct
gtctacaatgaagaaccctttgtctttagaaaagttgtactaccagatcttgctgtattg
aggatagcggtgtatgaggaaggaggtaaactaataggacagagaatcttgccattggat
ggattacaagcaggttatagacatatatcactgagaacagaaggtaacttccccttatca
ctgcctactgtcttctgctgtattcaactcaaaacatatgtaccagatggcttaacacag
tttgtagatgctctatcagatcctcagttgtatctatcacaggcagagaaaagagctaag
cagctcatatgcatgggcattgaagagaatgagattagtgaggtacccacagtgaataac
aagaagagaccaacggtacgacatccgacaacccctaccaacacagcaccaaacattggt
ggattctcaccgggtggacctactcataaccagagtaagaacttcatcactaggtgtcaa
gatggcaaagacaaacaaaaaggatttcagcccataacagcagacagcctaaggaaagaa
agagcatatcagaaactgctgaagaaacaacaaaaagagcaagattcattgaacaagaga
cattccaaagagagggccacattacagaagacacactactcaacggtcaacaagatggag
gcttgtcatgatagagagaaactcaccagagaaaagagtctagaaaaggccatcaagaag
aaaggggaaagcaactgctcagatctgaagatagaaactgagtgccatgtacaatcatta
gtcaatgaacacaaggcaagggtaagagacgtagtatcggaccagagcaaggagtttgct
gagatggtgaatcgtcagcaagcagaggagaggagtttgaaagataaccacatccagcag
agatgtgaccttctcaagaaactcatgctcagtactcaagaggaacaattacagctccta
gcggctagaaatgacagagaaatgaaggagctcaagtcaaatcaagccaaggattccatg
gaatcaaccaaaagtgttagccatgacaaaagtatcaagaacaaagcagagagagacagg
agagtaagggagcttcaaagtaataacacaaagaaattcttggaagagaggaaaaggctg
aaaatgaaacaagacaaagagaaagaggaagtacaacaggaacatagcaaacaaatggag
aaactacgcaaagaaattgacaagatggttgaagccgagaaggtagtgttagatggagca
gctaataaggtccaccttgctgcaagacctgactcctctacagtctga

DBGET integrated database retrieval system