KEGG   Strongylocentrotus purpuratus (purple sea urchin): 587532Help
Entry
587532            CDS       T01019                                 

Definition
beta-galactosidase-like
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Module
Keratan sulfate degradation
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    587532
  Lipid metabolism
   00600 Sphingolipid metabolism
    587532
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    587532
   00604 Glycosphingolipid biosynthesis - ganglio series
    587532
   00511 Other glycan degradation
    587532
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    587532
Enzymes [BR:spu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     587532
Exosome [BR:spu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   587532
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 671 aa AA seqDB search
MGRLRSYVSKLLICMAVLAVKQALPDRSFTIDYDSNTFLKDGQPFRYVSGSFHYSRVPAF
YWQDRLDKMKMAGLNAVQTYVIWNFHELKPGEFNFDGDHDILSFLKKANDTGLAVILRPG
PYICGEWDLGGLPAWLLNIPGIVLRSSNDLYMAHVTEWMNFFLPKLRPYLYVNGGPIIMV
QVENEYGSYQTCDHQYQRQLYHLFRANLGPDVVLFTTDGPGDHLLQCGTLQDMYATIDFG
AGSNSTGMFQEMRKFEPKGPLVNSEYYTGWLDHWEHPHQTVKTAAVCTSLDQMLALGANV
NMYMFEGGTNFGFWNGANYPTFNPQPTSYDYDAPLTEAGDPTPKYMAIRNVIGKYLPLPA
GPIPPPTKKYAYGVVEMEFTATIYDVLDQLCPYGPIMTDYPITMEAMQQYQGFMLYRTKL
PQNYATPANLTIEGIRDRGYVIIDQVWVGTLNRVNATSMNITGSEGMTLDIFVENQGHIN
YGSGLYDPKGIISNVTLDGAILQKWSIYSLDLDNILPKLQSLHRQRNRKMGNFIQERAPH
WRDGGYVPSFYLGSFPNLSAIDPPQDTFLKSSGWTKGQAFINDFNLGRYWPRAGPQVTLF
VPANLLRPSPVQNTVLFLELERPPCFNQTETCTVEFIDRPIINSTVAARPDETFRDRKYI
PEGHDFTDLRH
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgggaagattacgttcttatgtctcaaagttactaatttgcatggcggtattggctgtg
aaacaggcgctcccagatcgctccttcaccatcgactacgacagcaacactttcctgaag
gatggccagccgtttcgctacgtctctgggagctttcactacagcagggttccagcattc
tactggcaggacagactggacaagatgaagatggctggattgaatgcggtccagacatat
gtgatctggaacttccatgagctcaagcctggagagtttaactttgatggtgatcatgat
atcctctcgtttctcaagaaggccaatgatacaggtctagccgtcatcctcagacctggg
ccctacatctgtggagaatgggacctgggaggacttcctgcatggcttctcaacattcct
ggcattgtccttagatcatcaaatgatttatacatggctcatgtcacagaatggatgaat
ttctttctgccaaagctccggccgtacctttacgtcaatggagggcctatcatcatggtc
caggtcgagaatgagtacgggagctaccagacatgcgaccaccaataccagagacagctc
tatcacctgttccgtgccaatctgggtccagacgtggtcctcttcaccacggacggacca
ggggatcaccttctgcagtgtggcacgctgcaggatatgtacgcaacgatagactttggt
gcaggatccaattccacaggaatgtttcaagaaatgaggaaatttgagccaaaggggcct
ttggtcaattcagaatactacacaggctggttggaccactgggagcacccacatcaaacc
gtgaaaacagcagctgtctgtacatcacttgaccagatgcttgctttaggcgctaatgtg
aacatgtacatgtttgaagggggcaccaactttgggttctggaatggagcgaactacccg
acctttaacccccagcctaccagctatgactatgatgccccactcacagaggcaggagac
cccaccccaaagtacatggcaatcagaaatgtgatcggaaagtatcttcctctacctgct
ggacccataccccctcccaccaagaagtatgcctacggggtggtggagatggaattcaca
gcaaccatctacgacgtcttggatcagctgtgcccttatggaccaatcatgacggactat
cccattaccatggaagccatgcaacagtatcagggattcatgctctatcgtaccaagcta
ccgcagaactacgctactcctgcaaacctgaccatagagggcatcagagacaggggctac
gtcatcattgatcaggtttgggttggaacgttgaacagagtaaacgcaaccagtatgaac
atcacaggaagtgaaggaatgacccttgacatctttgtagagaaccaaggtcatatcaac
tatgggtcaggactttatgaccccaagggaatcatcagtaacgtcaccttagacggtgcc
atccttcaaaaatggtccatctattccttagacctggacaacattcttccaaaactacaa
tccctccatcgtcaacggaatcgcaagatgggaaacttcatccaagagagggcgccacac
tggagagatggaggctacgtaccatcgttctatctagggtcatttccaaatctttcagcg
attgatccaccgcaggataccttcttgaagtctagtggatggacaaagggccaagccttc
atcaacgacttcaatctgggcaggtactggcctcgggctggaccccaagtcacactcttt
gttccagccaacctacttagaccaagtccagtccagaacacggtcctattcttggaacta
gagagaccaccttgctttaatcagactgaaacatgtactgtagagtttatagatcgacca
ataatcaattccactgtcgctgctagacctgatgagacattcagagacaggaagtatatt
cctgaagggcatgattttactgatctcaggcattga

DBGET integrated database retrieval system