KEGG   Strongylocentrotus purpuratus (purple sea urchin): 587547Help
Entry
587547            CDS       T01019                                 

Definition
inositol monophosphatase 3-like
Orthology
K15759  
inositol monophosphatase 3 [EC:3.1.3.25 3.1.3.7]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Inositol phosphate metabolism
Sulfur metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, Ins(1,3,4,5)P4 => Ins(1,3,4)P3 => myo-inositol
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:spu00562]
Metabolism; Energy metabolism; Sulfur metabolism [PATH:spu00920]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:spu04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 358 aa AA seqDB search
MSFGMNNIKVNPVGMIFLVILGGGTLLLIRNSFYGKDKSSGSSEQGELVSMKQLLVASIQ
LAERGGRVVKEIRDTNKLNEASKGKTKEGANNPVTDGDMKSHEAIISGFQKSFPSVFVVS
EEHEDKVFDMNKVTPVAKDLPEVSKIIQSDEKIPVSDITVWVDPLDATQEYTEDLVEYVT
TMVCVAVKGVPTMGVIHKPFLENGPKTTWAWVGKGHAAHLKEIKHHTEALESPRIIVSRS
HSGQVEEVSKKTFGAGTKVNPAGGAGYKVMSLLEDQSDIYIHVTLIKKWDICAGNAILTE
MKSKMTTLKGETISYDRADDPKAPDGLLATVWDHTEFLAKLKPVYEELKADQKPKAKK
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttcggaatgaataacatcaaggtgaatcccgttgggatgatattccttgttatt
ctaggcggaggaacacttcttctcatcagaaattctttctatggaaaagataagagcagt
ggcagctcggagcagggtgaattggtcagcatgaagcagctccttgttgccagcatccag
ctcgccgagcgcggcggcagggtggtgaaggagattcgcgatacgaacaagctgaacgaa
gccagcaaagggaagacaaaagaaggagcaaataatccagtaaccgacggagatatgaag
tcacatgaggccattatatctggatttcaaaagtcatttccatctgtttttgtcgtctcg
gaggaacatgaagataaagtgtttgacatgaacaaggtgactcctgtggctaaggacctt
cctgaggtatctaaaatcattcaatcagatgaaaagattcctgttagtgatatcaccgtc
tgggtcgatcctctggatgcaacacaagaatatacagaggacttggtagaatatgtgaca
acaatggtctgtgtagcagtgaaaggagtaccgactatgggagtcatacacaaaccattc
ctggaaaatggacccaagacaacatgggcgtgggtaggtaaaggccacgcagcacacctg
aaggagatcaagcaccataccgaagccttggagagccctagaatcatcgtgtcaaggagt
cattctggccaggtggaagaagtttccaagaagaccttcggagctggcactaaggtcaac
cctgcaggaggagctggttacaaagtgatgtccctcctagaagaccaatcagacatctac
atccacgttacactcatcaagaaatgggacatatgcgccggcaacgccatcctgactgag
atgaagtccaagatgaccaccttaaagggggagaccatcagctacgacagggcggacgac
cccaaggcgccggacggactcctagcaaccgtctgggaccacacagagttcctcgcaaag
ctcaagcctgtctacgaagagctaaaagcagatcagaagccaaaagcaaagaaataa

DBGET integrated database retrieval system