KEGG   Strongylocentrotus purpuratus (purple sea urchin): 587567Help
Entry
587567            CDS       T01019                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 20
  KO
K11848  
ubiquitin carboxyl-terminal hydrolase 20/33 [EC:3.4.19.12]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Enzymes [BR:spu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     587567
Peptidases [BR:spu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   587567
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 739 aa AA seqDB search
MWKITGLTGLRNLGNTCYLNAGIQALSNCPAFAHFFLECNGFVKTEKKPYLAASYQRLME
DIWGRRRPSYLTPSSLVNSVKAVFPMFKGFTQQDSQEFLRCIMDRLHEELKEPVYPEPED
DDDTDGDTVKDNPEKDQQQTATRRRNRAPSPSLDTSSYHRTRSNDSLSITEEMETTGSLP
PDNDHYNASQSQEDAADERTSLQHHGASSAGGEEPRGHGVDKNHPHRKRTTDSFSETEPL
HPNPVPRGNCWSKFQYVALTSRTRTTSSSSTKYDREVYDSEKDIDEMASGDQGMNNSREH
AKKKKQPLRYRSIISDVFDGKILSSVQCLTCENISCQKRNVPGTCPFTFPGERKDLPGSR
DGWDMLYSYWHLPVSWFWGPNVTLDNCLAAFFSADELKGDNMYSCEKCKKLRNGVKFVHV
LELPEVLCIHLKRFRHESFTSYCSKLNNYVSFPLDSLDMTPYLSKDCKNKCATYDLSAVI
CHHGTAGGGHYTSYAVNWLNGQWYEYDDIYVTEVSTMQVANCEAYVLFYKKTSEEANKER
QRVIDLFEQEEVASFLHFYVSLHMANKLNNFAEPGPITNHDFLCKHGGVQPRKASYVEKL
VLKIPQPVWDHLYQTFGGGPAVNRLSPCSVCQAEMELLERRRKEEMETFITVSIRFKAKQ
AEPPGLIDNKLIAVTKGGYTTLKQGADSGQISEAMWEYLHGIYDGGPEVVLRPNPAPSVE
GRGEEGAPTGSNSPREETS
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaaataactgggctgactggactgagaaatctaggcaatacttgctacctgaat
gctggtatacaggctctttctaattgcccagcatttgcacacttcttcctggaatgcaat
ggttttgtgaagactgagaagaagccttacctagcagcctcataccagagactcatggaa
gacatatggggacgaagaagacccagttatttgactccatcaagtcttgtaaacagtgtg
aaggctgtctttcctatgttcaagggctttacacaacaggattcgcaggagttccttcgc
tgcatcatggatcgtctccatgaggagctgaaggagccggtttacccggaaccagaggac
gacgacgacaccgatggagacactgtcaaggacaacccagagaaggaccaacaacaaacc
gccacccgacgacgcaaccgcgccccttccccatccctcgacacgtcgtcctaccatcgt
acccgctctaacgattccttgagcatcacggaagagatggagacgacggggagcttgcca
ccggataatgaccattacaacgcctcccagtcacaggaggatgctgctgacgagaggaca
tccctgcagcatcatggagcatcatcggcgggaggtgaggaacccaggggtcatggggtc
gataagaaccatccgcatcggaagaggaccaccgattccttttcagagacagaaccactt
catcctaacccagtaccaagaggtaattgttggtctaaattccagtatgttgcgctgact
agtcgaacacgcaccacatcgtcatcgagcaccaagtacgatcgggaagtctacgacagt
gagaaggacatcgacgagatggcttctggtgatcaggggatgaataacagcagagagcat
gccaagaagaagaagcagcctctgaggtatcgtagcatcatctcggatgtgtttgatgga
aagatcttgagctcagtccagtgtctcacctgtgaaaatatttcctgtcaaaagagaaac
gttccagggacctgtcccttcacattccccggtgaaaggaaggacctgcccggatccagg
gatggatgggacatgttatatagctactggcaccttccagtgagctggttctggggtcct
aatgtcacccttgataattgcttggctgctttcttctctgctgatgaactcaaaggtgac
aacatgtacagctgtgaaaagtgtaaaaaactcagaaatggggtcaagttcgttcatgtc
ctggaactaccggaggtcctctgtatccatctgaagcggttccgccacgaatccttcacc
tcctactgctctaagttaaacaactacgtctccttccctctggacagcctggacatgaca
ccgtacctctctaaagattgcaagaacaagtgtgcgacctatgacctgagtgcagtcata
tgtcatcatggcactgctggaggtggtcactacaccagctacgctgtgaactggctcaac
ggccagtggtacgaatacgacgatatctatgtcactgaggtcagcaccatgcaggttgct
aactgtgaagcttacgtactcttctacaaaaagacatctgaagaagccaataaagaaaga
caaagagtcatagatctctttgaacaagaagaggtagcgagctttcttcacttctatgtg
tctctgcacatggcgaacaaactgaataactttgccgagcccgggccaatcacaaaccat
gacttcctctgtaaacatggaggagtgcagcccaggaaggcaagctatgtggagaagttg
gtattgaagatacctcaacctgtatgggatcacctctaccagacgtttggtggaggacca
gctgtcaatcgcctctctccttgctctgtgtgtcaagctgagatggaactattagagaga
agaagaaaagaagagatggagacgttcataactgtaagcattcggttcaaagctaaacaa
gctgaacctcctggactgattgacaacaaacttattgcagtgacaaaaggtggctacaca
acactcaaacaaggagctgattccggacagatctctgaggccatgtgggagtatcttcat
ggaatctatgatggtggaccagaggtcgtcctccggcccaaccctgcccccagcgtcgaa
ggcagaggagaggagggggcacctacaggtagcaacagcccccgggaagaaacgtcctag

DBGET integrated database retrieval system