KEGG   Strongylocentrotus purpuratus (purple sea urchin): 587708Help
Entry
587708            CDS       T01019                                 

Definition
palmitoyl-protein thioesterase 1-like
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    587708
  Lipid metabolism
   00062 Fatty acid elongation
    587708
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    587708
Enzymes [BR:spu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     587708
Lipid biosynthesis proteins [BR:spu01004]
 Fatty acid synthase
  Component type
   587708
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 268 aa AA seqDB search
HGMGDSCCNPLSMGSIKNLVEKQVPGIYVNSLEIGSDIVADMANGFFMDGFAQIKMACDI
IAKDPKLKNGYNAIGFSQGGQFLRAVAQMCPNPPMHNLISAGGQHQGVYGFPRCPGDNST
LCNLAREMLNLGAYESFVQDNLVQAQYWHDPINEAEYKQYSKFIAIINQENYVNQTYKKN
LVTLNKFVMVMFGEDTMVEPKESEWFGFYVAGTTSKLYTLRESQLYIQDKLGLKQMDAAN
KLVFLTAPWDHLRFSDEWFIANLIPYMK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
catggtatgggtgacagctgctgtaacccactaagcatgggaagcatcaagaatcttgtg
gagaagcaggttccaggcatctatgtcaactccctggaaataggcagtgatattgttgct
gatatggccaatggttttttcatggacggcttcgctcagatcaaaatggcttgtgacatc
atcgctaaggaccccaagctcaagaacggatacaatgctatcggcttctcacaaggggga
cagttcttgagagctgtggcccagatgtgcccaaaccctcccatgcacaatctcatatct
gcaggaggccaacaccaaggtgtctatggcttcccgcgatgtccaggagacaattctact
ctgtgtaaccttgcaagagagatgctcaacttgggtgcttacgagagctttgtacaagac
aatctcgtgcaggcccagtactggcatgatcctatcaacgaagccgagtacaagcaatac
agcaagtttatcgccatcatcaaccaagaaaattatgtgaatcagacttacaagaagaac
ctggtgacgctgaataagtttgtgatggtcatgtttggtgaagacaccatggtcgaaccc
aaagaatcagagtggtttggtttctatgtcgccgggaccacctctaagctgtacacgctg
agagaaagccaactatacattcaggacaagcttggtttgaagcagatggacgcagccaat
aagttggtcttcctcacggcaccctgggaccatcttcgcttctccgatgagtggtttatc
gccaacctcattccgtatatgaaatag

DBGET integrated database retrieval system