KEGG   Strongylocentrotus purpuratus (purple sea urchin): 587933Help
Entry
587933            CDS       T01019                                 

Definition
pyruvate dehydrogenase [lipoamide] kinase isozyme 2-like
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Enzymes [BR:spu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     587933
Protein kinases [BR:spu01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   587933
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 411 aa AA seqDB search
MVRLTVRLLAMAKKNMQAQMEYYSKFSPSPLSIKQFMDFGQSKDVDSAKSFVFLRQELPV
RIANIMKEINLLPEKLLQMPSVRMVQGWYQQTFEELLEYVEKTEEEDPVLLRYINQLTTI
RNRHVNVVETMAQGILEMRESYKVDQHEENNVQYFLDRFYISRISIRMLINQHTLMFGQI
PTTHPLLVGSIDPSCDIVAVIRDAYDSAKYLCDQYYLASPDIDVRWIDARDGSDSIRMVY
VPSHLYHIMFELLKNAMRAVMEHKGPSASEFPPIGILVTKGKEDVTIKVSDEGGGIPKSE
IDLLFNYMYSTAPAPPKPGVSIIPPLAGYGYGLPISRLYAKYFHGDLTLSSMDGYGTDAV
VYLKVLSSEASELLPIYNSAVSRYYKTPTPASDWSTPGYFIRNYTTKRYGK
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atggttcgcttgactgtgcgcttactcgctatggcgaagaagaatatgcaggctcagatg
gaatactactcaaagttttccccatctcctctttctatcaagcagttcatggattttggt
cagagtaaagatgttgactcggccaagtcgtttgtgtttctgaggcaagaacttccagtc
aggattgccaacatcatgaaagagatcaacctacttccagagaagcttctacaaatgcct
tctgtccgtatggtacaaggatggtatcaacaaacatttgaagaactgctagagtatgta
gagaagacagaagaggaggatccagttttattacgatacataaatcaactcaccacgata
aggaacaggcacgtcaacgtcgttgagacaatggcacagggtatactggaaatgagggaa
agctacaaagtagaccaacatgaagagaacaatgtacagtattttctggatagattctac
atctcaagaattagcatcaggatgctcatcaaccaacacacattgatgtttggacaaata
cccacgacgcaccctctccttgttggtagtatagacccaagttgtgacatcgtagctgta
ataagggatgcgtatgacagtgccaagtacctttgtgatcagtattaccttgcttcacct
gacattgatgtgaggtggattgatgctcgtgacggcagtgacagtatacgtatggtgtat
gtaccctctcatctctatcacatcatgtttgagttattaaagaatgcaatgcgtgccgtg
atggaacacaaaggaccttctgcctctgaattccctcccattggaatcctagtcaccaag
gggaaggaagacgttaccatcaaggtatcggatgaaggaggtggaattcctaagagtgag
attgatctgctcttcaactacatgtactccaccgcccccgcacctcctaagcctggtgtc
agcataataccacctctggctggctatggatatggtctgcccatctcaagactgtatgcc
aagtatttccacggtgacctgacgcttagctccatggacggctatggcactgatgcagta
gtctacctcaaggtactatcgagcgaggcttcagagcttttacctatctacaacagcgct
gtgtcaaggtattacaagacacctacccctgcaagcgactggagtactccgggttacttc
attcgaaactacaccaccaagagatatgggaaataa

DBGET integrated database retrieval system