KEGG   Strongylocentrotus purpuratus (purple sea urchin): 587970Help
Entry
587970            CDS       T01019                                 

Definition
(RefSeq) calcineurin subunit B type 1
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 EF-hand_4 SPARC_Ca_bdg EF-hand_9
Motif
Other DBs
NCBI-GeneID: 587970
NCBI-ProteinID: XP_011674052
Position
Un
AA seq 103 aa AA seqDB search
FVRHFAEFIQGVSQFSVKGDKESKLKFFFRIYDMDRDGFISNGELFQVLKMMVGSNLKDT
QLQQIVDKTITNADLDGDGKISYDEFCTVVANTDIHQKVVVDV
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
tttgtccgtcactttgcagagttcatccagggtgtttcacaattcagtgtgaagggagac
aaagaatcaaaacttaaattcttctttaggatctatgacatggaccgggacggtttcatc
tcaaacggggagttgttccaggtcttgaagatgatggtgggatcaaacctcaaggacacg
caactgcagcagattgtagacaagactatcaccaatgcagacttggacggggacggcaaa
atatcctacgatgaattctgcactgttgttgcgaataccgacatccatcagaaagtggtc
gttgatgtatag

DBGET integrated database retrieval system