KEGG   Strongylocentrotus purpuratus (purple sea urchin): 587970Help
Entry
587970            CDS       T01019                                 

Definition
uncharacterized LOC587970
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 603 aa AA seqDB search
MASYNNQEAWRPVSVPLPAVLNQSTATQTVGLFYPTHEQVTRSPQDVEAVRQVREQITTG
TGTGTGPAQEKARLTDISPGKGYWKRQIAHIAAHLEAFSQKDAEFRAGVGKPKMGKHYSP
YGATTRKKKPLTKRLAAKKKVEEERLTPEEKQLIRELGPRGEGNIDIVQDMLDEGADPNC
ETKDGVSAIVHAAMNNQVESIPLLADAGAEINRKTPVRKGNTALHEAVLLGPDGQEVIEA
LLDSGANPKVQNNKGDMPYDLAVANGYSSIVALFTSSMGQDMLKKMTHSKKDKGKKGRRK
ETESEDESEEEEKPRRKSKKYKEKLPKDKGTVVPVSKFNPENDAEKLRKAMKGLGTDEQA
IIDVLANRSNDQRQKIAKQFKQMFGKDLLKELKSELSGKLLDVVQGLMMTPSQYDAYQLN
KAVKGLGTNEEILIEILCTRTNSSIEAIKNVYEDAYGEELEEAIADDTSGHFERLLISVL
QGSRPEGDEVDPDKAKADAEFVRHFAEFIQGVSQFSVKGDKESKLKFFFRIYDMDRDGFI
SNGELFQVLKMMVGSNLKDTQLQQIVDKTITNADLDGDGKISYDEFCTVVANTDIHQKVV
VDV
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atggctagctacaacaaccaggaggcgtggcgaccagtcagtgtgcccctccctgctgtc
ctcaaccaatccaccgccacccagaccgtcggcctcttctaccccacccacgaacaggtc
acccgctcgccccaggacgtggaggcggttcgccaggtccgggagcagatcaccactgga
acgggaacgggaacgggccccgcccaggagaaggcgcggctgacggacatcagcccgggg
aagggttactggaagcggcagatcgcgcacatcgcggctcaccttgaggcgttctcgcag
aaggacgcagagttcagagctggcgtgggaaaacccaagatgggcaagcattattcgcct
tatggagcgacaacaaggaagaagaaacccctgactaagaggctagcagccaagaagaaa
gtagaagaggagagattgacgcctgaggagaagcaattgataagagaattgggaccaaga
ggagagggcaacattgatattgtgcaagacatgcttgatgagggagcggatcctaactgc
gagaccaaggatggagtctcggccattgtacatgctgcaatgaacaaccaggtggagagt
ataccgttacttgcagacgcaggggcagagattaacagaaagacaccggttaggaagggc
aacacagctctccatgaggccgtgctcctcggcccggacggccaggaggtcatcgaggcc
ctcctcgactcgggcgctaaccccaaggtccagaacaacaagggcgacatgccctacgac
ctggccgttgccaacggttactcgtccatcgtggcgcttttcacctccagtatgggccag
gacatgctgaagaagatgacgcattccaagaaggataaaggaaagaaggggaggaggaag
gagacggagagtgaggacgagagcgaagaggaggagaagccaaggaggaagagcaagaag
tataaagagaaactgcccaaggataagggcactgttgtccccgtgtcaaagttcaaccct
gagaacgacgctgagaaactcaggaaagccatgaaaggattaggtactgatgagcaagca
atcattgatgttctcgctaatcgatcaaacgaccaacggcagaagattgccaaacagttc
aagcagatgtttggaaaggatttattgaaggaactcaagagtgagctgagtggcaaactc
ttggatgtagtacaaggactgatgatgaccccttctcagtacgatgcttatcaactcaac
aaggcagtcaagggtctgggcaccaatgaggagatactgattgaaattctatgtacaaga
accaacagctccatcgaagccatcaaaaatgtgtacgaagatgcgtatggagaggagctg
gaggaagccattgctgatgatacctcaggccactttgagcggcttctgatctctgtcctg
caggggtccaggccagagggagacgaggtggatccagacaaagccaaggctgatgcggag
tttgtccgtcactttgcagagttcatccagggtgtttcacaattcagtgtgaagggagac
aaagaatcaaaacttaaattcttctttaggatctatgacatggaccgggacggtttcatc
tcaaacggggagttgttccaggtcttgaagatgatggtgggatcaaacctcaaggacacg
caactgcagcagattgtagacaagactatcaccaatgcagacttggacggggacggcaaa
atatcctacgatgaattctgcactgttgttgcgaataccgacatccatcagaaagtggtc
gttgatgtatag

DBGET integrated database retrieval system