KEGG   Strongylocentrotus purpuratus (purple sea urchin): 588190Help
Entry
588190            CDS       T01019                                 

Definition
group XV phospholipase A2-like
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Glycerophospholipid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    588190
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    588190
Enzymes [BR:spu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     588190
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 433 aa AA seqDB search
MTRSTLFTLITAFILFSTHIHTISALFDGPPVVLIPGDGGCQLQATLNRTATLHPYICQK
TSGLFTLWLNLDEFVPYYFDCFIDNMKLVYDPATRTSRDSEGVHVYIPGFGNTSTVEWLD
PSKSSFGSYYTHLVDALVAVGYERNVNIRGAPYDFRKAPNEGGSYFWQLQHLVEETYQKN
GHEPVVLVSHSLGCLYALYFLNQQPTSWKNRFIRAWVPISGPYAGTTKVMRVVTSGDNLN
EYVISALTARNAQRSYPSSVFLFPNTDYWSPEEIIITTPKANYTTRNYTQLFKDLNYTIG
LDLLQDTQGLVKDIKAPDVAVFPVYGVEVPTEANYTYPGNSFPDTQPTISMGLGDGTVNL
RSLRAYRKWRNEQYSPVREYEVKGPTGEHSAILAEKSVFRFIINEVLFPFIKLNSTTSKK
RSKLSPRKSPKLT
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgactagatctacgttatttacactaattaccgcctttatactattctcaactcatatt
catacaatttctgctttatttgatgggcctccagtggtattaattcctggtgatggtggt
tgtcagttgcaggcaactttgaacaggacagctactcttcatccatacatctgccaaaaa
acaagtggccttttcaccttatggctcaatcttgatgagtttgtgccctactactttgac
tgtttcattgataatatgaaactagtctatgatccagccacaagaacaagccgagatagt
gagggtgttcatgtgtacatacctggttttggaaatacaagcactgtggagtggttagac
ccaagcaaaagttcatttggttcatactacactcatctagtggatgccttggttgctgtt
ggttatgaaagaaatgtcaatatacgtggagctccttatgacttccggaaagcccccaat
gaaggcggctcatatttctggcagttacagcacttagtagaagaaacgtatcagaagaat
gggcatgaacctgttgtacttgtatcacacagtctaggatgtctctatgcgctgtacttc
ctcaaccagcagcccacatcatggaagaaccgattcatcagggcatgggttccaatctcg
ggaccctacgccggtaccaccaaagtcatgcgagttgtcacgtcaggtgataatctgaat
gaatatgtgatatcagccttgactgctcgcaatgctcagcgttcctaccccagctcagtc
ttcctcttccctaatacagactattggagcccagaagaaatcatcattactacacccaaa
gctaactacacaacaagaaactacacacagctattcaaagatttgaattatactatagga
ttagatctccttcaagatactcaagggcttgtgaaggatatcaaagcaccagatgttgct
gtatttcctgtgtatggtgtggaggtacctactgaagctaactacacatacccaggaaat
tcatttcctgacacgcaaccaacaatatcaatgggcttaggtgatggaacagttaatcta
cgcagccttagagcatataggaaatggcgtaatgagcagtactcacctgtgagggagtat
gaagtgaaaggcccaacaggagaacattctgctatcctagctgagaagtcagtcttcagg
tttatcatcaatgaagtcttattcccattcatcaagctcaattctacaacttccaagaaa
aggagcaaactcagtcccaggaaaagtccaaagctaacatga

DBGET integrated database retrieval system