KEGG   Strongylocentrotus purpuratus (purple sea urchin): 588243Help
Entry
588243            CDS       T01019                                 

Definition
glutathione peroxidase 1-like
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    588243
  Metabolism of other amino acids
   00480 Glutathione metabolism
    588243
Enzymes [BR:spu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     588243
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 123 aa AA seqDB search
MSMYVKIENCKNEEILDLLKYVRPGQGYSPQFPIFSKVTVNGKDTHPLYTFLKTTLPFPS
DLAAGAGSVLMNDPKGIIWNPVRRYDISWNFEKFLIGQDGVPFGRYSPKLPPADLAGDIE
KLL
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgagtatgtatgtgaagattgagaattgcaagaatgaagagattctggacttgctgaaa
tatgtaagaccaggacaaggttatagcccccagtttcctatcttctctaaagtgacagtc
aatggcaaagacacccaccccctctataccttccttaagaccaccctcccctttcccagt
gacctggcagctggggcggggtcagtcctcatgaacgaccctaaaggaatcatctggaac
cccgtcaggcgttatgacatcagctggaactttgagaagttcttgatagggcaagatggg
gtaccgtttgggaggtacagtcccaaactaccccctgctgacttagctggtgatattgag
aaacttttgtag

DBGET integrated database retrieval system