KEGG   Strongylocentrotus purpuratus (purple sea urchin): 588838Help
Entry
588838            CDS       T01019                                 

Definition
calcineurin subunit B-like
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Wnt signaling pathway
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:spu04310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 183 aa AA seqDB search
MGNSDSLLTPERLEDIQEQSHFDEKEIKFLLKTYAKLDPSPEGEDGIPVESFLSLYIFAG
NELARRVVLKHASGPDRTIQPEGFLLCLSVLSKKADYPEKSKALFDALDVNKEGLVRFEQ
LFSLYKGMFTPALSDDQIMEAVIGALQKVRGQHPGTISYQEFLRMVSPTELNQKMTIDIP
LPT
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgggtaattcagactctcttctcacgccagaaagactggaagatattcaagagcagtca
cattttgatgaaaaagagattaagtttctgctgaagacttatgccaaactggacccctcc
cctgaaggtgaggatggtatccccgtggaatctttcctttccctttacatctttgctggc
aatgagcttgcaaggagagtggtattgaaacatgctagtggaccggaccgtaccattcag
ccagaggggttcttgctgtgtctgtctgtgctgagcaagaaagcagattatcctgagaaa
agtaaagccctctttgatgcgctagatgtgaacaaagaaggtcttgtaagattcgagcag
ctcttcagtctctacaagggtatgttcacccctgcattgtcggatgaccagataatggag
gctgtaattggtgcattgcagaaggtcagaggtcaacatcctggcaccatctcataccaa
gaatttctgaggatggtgtcgcccacagagctgaaccagaagatgacgatcgacattcct
ctgccgacatga

DBGET integrated database retrieval system