KEGG   Strongylocentrotus purpuratus (purple sea urchin): 588847Help
Entry
588847            CDS       T01019                                 

Definition
L-asparaginase-like
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Enzymes [BR:spu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     588847
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     588847
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     588847
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 142 aa AA seqDB search
MDSIRNRKLDTIEIIKQCGGHLINESPFELAVLLCSAAATNDVTGLQAYHMAGVDMMCTD
YSGNTALHVAAINNQLEAIQYLLESHVIPANKPNGEGFTAAELAAQHGHQKTASLIKELT
DKLKEKIPSGSFKLNGGPNRST
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atggacagcattagaaatagaaaacttgacaccatagagataatcaagcagtgtggtggt
cacctgatcaatgagagtccctttgaactggctgtccttctatgcagcgctgcagcaaca
aatgatgtaacaggattacaagcataccatatggcaggagtggatatgatgtgcacagat
tatagtggcaatacagcacttcatgtggctgcaatcaacaaccaacttgaagcaatacag
tacttactagaatctcatgtgatcccagccaacaaacccaatggagaaggcttcactgca
gctgagttagctgcccaacacggtcatcagaagactgcttcacttattaaagaactcaca
gataaattaaaggagaagatacctagcggtagtttcaagctcaatgggggacctaatcga
tcaacgtag

DBGET integrated database retrieval system