KEGG   Strongylocentrotus purpuratus (purple sea urchin): 588991Help
Entry
588991            CDS       T01019                                 

Gene name
pomt1
Definition
protein-O-mannosyltransferase 1
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:spu00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 762 aa AA seqDB search
MPGNNENKVRKRVKQEENAGELRVSGDQQTKDESSPAVTAESLTGVGKWGNLVASPSSFV
FTLNINALIAVLTFVSFVTRFWRLEEPRGVVFDETHFGLFTSFYLKGMFFFDVHPPLGKL
LIASVGYLAGFQGDFSFEKIGQEYPCEVPIWHLRFLPALCGSLLTPLTFYILEGMGFSQW
TAAVGAFLVVCDNSLLTQSRFILLDTILLCFILLSFLALLRFRQVQDKPFSIQWWIWLTC
LGVFLSCTISVKYSGLFTSVVILGVITADYWTMVGDRGVSNSHLFKEMLARAVLLIIVPV
VLYLSFFYIHLTVLYRSGPHDGRMSSAFQASLEGGLAKVTQGQPKNIAYGSQITLRHTHS
TVCWLHSHPHLYPLRYSERRGSSIQQQVTCYTFKDVNNWWVVKDPEEEGFTTENPQRPVK
DGDIIQLIHGTSGRRLNSHDVGAPMSPQYMEVSCYIDYNISFPAQDLWRVEIVNKDVQGN
LWKAIHSHIRLTHVNTSQAMKLTGQQLPDWGFYQHEVATDRVMNQDSNIWNVEENKHSSD
KEDDFWDDTKELSFFSKFWELQWKMLEANRNLLEDHKYQSDPMGWPFMERGIAYWMKSTT
NAQIHLLGNVITWWSANLGIVVYLVVMVIYIIRHQRACNDLTKDEWIRLFMTGALFLSWF
VNYFPYFMMERTLFLHHYLPAFLSKILLLAATIEIVYFHVLQTSAQRSLFTSLLVVWLTS
IFVVFKSFLPMCYGNKDFTEEEVESLRWMESWGFLVQGKMIA
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atgcctggaaacaatgaaaacaaagtccgaaaacgggtgaaacaggaggaaaacgctggg
gaacttcgagtgagtggggatcagcagaccaaagatgaatcgtccccggcagttacggct
gaaagtcttacaggtgtagggaagtggggaaatttagtagcgtcaccatcgtcattcgtt
ttcacattgaatatcaatgctttgattgcagttcttacgttcgtgtcttttgttacacga
ttttggaggctagaagaaccgaggggagttgtgtttgacgagactcattttggtctgttc
acaagcttctacctcaaagggatgttcttctttgatgtgcacccgcccctaggcaagcta
ctcatagcctctgtgggctacttggcgggctttcaaggagacttctcttttgaaaagatt
ggtcaagaatacccatgcgaagttccgatatggcacttgcgcttcctaccagccctctgt
gggtctctgcttacccctctcacattctacatcttggaaggtatgggattcagccaatgg
acagcagctgtaggagctttccttgttgtgtgtgataattctttgttgactcagtctcga
ttcatcttgttggataccatattgctgtgtttcatcctgctgtcttttctagctcttctg
agattcagacaagtacaggataagccatttagtattcagtggtggatatggctaacatgc
ttgggagtcttcctctcatgtactataagtgtgaagtattctggtttgtttacatcagtt
gtcatccttggtgttattacagctgattactggactatggttggtgacagaggcgtctca
aattcccacctattcaaagagatgttagcaagagcagttctactcatcattgtgcctgtg
gtgctatacctatccttcttctacatccacctgactgtgttgtatcggagtggtcctcat
gatggacggatgtccagtgcattccaagcctccttggaaggaggcttagcaaaggtcact
cagggtcaaccaaagaacatagcctatggttcacagatcactctccggcatacacacagc
actgtttgctggctccactctcatccccatctttacccattgagatactcggaaagaagg
gggagcagcatacagcagcaggtcacatgctatacattcaaggatgttaataattggtgg
gtagtgaaagaccctgaggaagaaggattcacgacggagaatcctcagagacccgtcaaa
gatggtgacatcatccagttgattcatgggacctcgggtcggcgacttaacagtcatgat
gtaggtgctccaatgtcacctcaatacatggaggtatcatgttacattgattacaacatc
tcctttcctgctcaagacttatggagagtggaaatagtgaacaaggatgtccaaggtaat
ttatggaaagcgatccattcacacatcagactgactcatgtcaatacatcacaagctatg
aagttgaccggtcaacagctcccggattggggtttctaccagcatgaagttgctacagat
cgtgtcatgaatcaggactccaacatctggaatgtggaggaaaataaacattcaagtgac
aaagaagatgacttctgggatgatacaaaggagctaagtttcttcagtaaattctgggaa
ttacagtggaagatgctggaagcaaataggaatctgctagaggatcacaagtaccaatcg
gacccgatgggatggcccttcatggaacgcggtattgcctactggatgaagtcaaccaca
aatgctcagattcatctccttggtaacgtgatcacatggtggtcagctaatctagggatt
gttgtttatctggtcgtcatggtcatctacatcatacgacatcagagagcttgcaatgat
ctcacaaaagatgaatggattcgtcttttcatgacaggcgccctcttcctgtcatggttt
gtcaactattttccatactttatgatggagcgtaccctctttctacaccactacctgcca
gcatttctctcaaagatcctacttttggctgctacaattgagatagtttacttccatgtc
ttgcagacttctgctcagcgtagtctcttcaccagccttctggttgtttggctgacatcc
atcttcgtagtcttcaaaagcttcttgccgatgtgttatggaaacaaggacttcactgaa
gaggaggtggaatctctgcgatggatggagagctgggggttccttgtgcaaggaaagatg
atcgcataa

DBGET integrated database retrieval system