KEGG   Strongylocentrotus purpuratus (purple sea urchin): 589201Help
Entry
589201            CDS       T01019                                 

Definition
tyrosine-protein kinase SYK-like
Orthology
K05855  
spleen tyrosine kinase [EC:2.7.10.2]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Enzymes [BR:spu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     589201
Protein kinases [BR:spu01001]
 Tyrosine protein kinases
  Syk family
   589201
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 718 aa AA seqDB search
MERTSILNSTNHHHHHNNHHQQQHPVSPTPKINHHYHQQLVQPGRIMPVDPLSRRFYHGR
ITREEAEARLRNAGCHQGMFLLRESLGREGNYALSLCYEDDVYHYAIERQYDGTVAIKDG
KNFAGPIELVSNHMNREDGLLCRLLRPCNLQQGIAARAFSDMDHQQMEGALIDLAKSQGM
APEVITKALHSTQRPQLERALKKIMHQDKPWFHHKLSREEAEQRIVSAGLQEGKFLVRER
TEEGSFALSLCYNNFVYHYKIDKDCTGQLSIKEGPKFDSLIQMVDHYQLKKDGLLCCLLV
PCHDNNRDTPTRRRHSDIPPQRAGKNQRRIASEDGGGVPPTPLRTALSVSVSSPPGIRAP
LEYNPSPPTPNRTNSSNNVNDLHLTQMGGHGWDEPEHEEELPSQRPREYHDDDDKIYGVA
NEQEKLYDYLAKTKTTKKLDATCLNQGDQIGKGNFGSVLKGTCMANGQLIPVAVKTLKAD
FGIPNSEPEIVREAELMAGLDHPHIVRMIGICHAAEMMLVLELAELGPLHKYLKKHQEMS
TRNVLELMYQVAQGMCYLESRQFVHRDLAARNVLLVDETFAKISDFGMSKALGLDSQYYV
AETAGKWPLKWYAPECIYKFKFSSKSDVWSYGVTLWEALSYGKRPYASMRGQELMQFIEN
GDRLSQPDRCPDDVYSLMRRCWLSEAKDRPGFGDIESVLSDILKRLQAGTLRMRTDRQ
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atggaacgcacctccatcttaaactctaccaaccatcaccaccaccacaacaaccaccac
cagcagcaacatccagtgtcaccaacccctaaaatcaaccaccactaccaccagcaactc
gtacaacccggccgcatcatgccagtggacccgctctcacgccgcttctaccacggccgg
atcacgagggaagaggccgaggcacggctacggaatgccggctgccaccaggggatgttc
ctactgcgagagtccctaggtcgggagggcaattacgccctctccttgtgctacgaggac
gacgtctaccactatgccatcgagcggcagtacgatggcacagtggccatcaaggatggc
aagaactttgcaggccctatcgaacttgtgtcgaatcatatgaaccgagaggacgggctg
ttgtgcagacttctaagaccatgcaaccttcagcagggtatcgccgcaagggccttcagt
gacatggatcatcagcagatggaaggagctctgatagatctcgccaagagccaaggaatg
gctcctgaggtgatcaccaaggcactccactccactcagcgtccgcagctggaacgagcc
ctgaagaagatcatgcatcaagacaaaccctggttccatcacaagctctcgagggaggag
gcagagcagaggatcgtctctgccggtctacaggaaggaaaattcttagttcgagaaagg
acagaagaaggaagttttgctctgtcgctgtgctacaataactttgtctaccattacaag
atagacaaggattgcaccggccaactttctatcaaggaagggccaaagtttgatagcctt
attcagatggtggatcactaccagctgaagaaagacggtttactctgctgccttctcgtc
ccctgtcacgacaacaaccgagacacgcccactaggaggcggcactcagacattccaccg
cagagagctggtaaaaatcaaagacgaatcgcatctgaagatggaggaggtgttcccccg
acccctttgagaacagccctctctgtatcggtgtccagtccccctgggataagggcaccc
ctggagtacaacccttcgccccccacgcccaacaggaccaactccagcaacaacgtcaat
gacctccacctgacccagatgggcggtcacggctgggacgagcccgaacacgaagaagag
cttccatctcagaggcctagagaataccacgacgacgatgacaagatttatggagtagcc
aacgagcaggagaaactgtacgactacctggccaagaccaagaccaccaaaaagctggac
gctacttgtctcaaccagggagatcagataggcaagggtaactttgggtcagtattaaaa
ggcacctgtatggccaatggtcagctcattccagtagcggtcaagacgctcaaagcagac
tttggcattccaaactcagagcctgagatcgtgagagaagcagaacttatggcaggcttg
gatcatccacacatagtcagaatgataggtatatgtcatgcagcagagatgatgctcgtt
ctggagctagcagaactcggacctctccacaaatacctcaaaaaacatcaggagatgagc
accaggaacgtgttggagttgatgtaccaggtggcacagggtatgtgctacctcgagagc
aggcagttcgtccatcgcgacctcgcggcgcgaaacgttcttctcgttgacgagaccttc
gccaagatcagtgattttggcatgtccaaagctctaggacttgacagccagtactatgtg
gcagaaactgctggcaaatggccactgaaatggtatgcaccggaatgcatctacaaattc
aaattcagcagtaagagtgatgtgtggagctacggggtgactctctgggaggctttgtcc
tatggaaagagaccgtatgcaagtatgagagggcaggagctgatgcagtttatagagaat
ggagaccgattatctcagcccgacagatgtccagacgatgtctacagtctcatgaggaga
tgctggctatcagaagccaaggatcgaccaggcttcggagacatcgaaagcgtcttgtcg
gatattctaaagcgcctgcaggcagggaccctgagaatgagaacggacaggcaatga

DBGET integrated database retrieval system