KEGG   Strongylocentrotus purpuratus (purple sea urchin): 589639Help
Entry
589639            CDS       T01019                                 

Definition
gem-associated protein 7-like
Orthology
K13135  
gem associated protein 7
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
RNA transport
Module
Survival motor neuron (SMN) complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:spu03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 96 aa AA seqDB search
MADTDTEDRSQEQVARSFLRRRFLHFLIAVSKHKMDFVMHEHTNVSGEFGMMDINVQQVQ
VSNLKTPIGVQKEAILRTSDIVAFTLQVPLEKVPEG
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atggcagacactgatacagaggacaggtcgcaagaacaagttgccaggtcgtttctccgt
cgcaggttcctgcacttccttattgccgtttcaaagcacaagatggactttgtcatgcat
gagcacaccaacgtttctggagagttcggcatgatggacatcaatgttcagcaggtccag
gtctccaatctaaagacacccatcggagtgcagaaagaagccattcttagaaccagtgac
atcgtggcttttacgcttcaagtgccgttggagaaagttccagagggttga

DBGET integrated database retrieval system