KEGG   Strongylocentrotus purpuratus (purple sea urchin): 589639Help
Entry
589639            CDS       T01019                                 

Definition
gem-associated protein 7-like
Orthology
K13135  
gem associated protein 7
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
RNA transport
Module
Survival motor neuron (SMN) complex
Brite
KEGG Orthology (KO) [BR:spu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    589639
Spliceosome [BR:spu03041]
 Other splicing related proteins
  Proteins involved in snRNP biogenesis
   SMN complex factors
    589639
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 96 aa AA seqDB search
MADTDTEDRSQEQVARSFLRRRFLHFLIAVSKHKMDFVMHEHTNVSGEFGMMDINVQQVQ
VSNLKTPIGVQKEAILRTSDIVAFTLQVPLEKVPEG
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atggcagacactgatacagaggacaggtcgcaagaacaagttgccaggtcgtttctccgt
cgcaggttcctgcacttccttattgccgtttcaaagcacaagatggactttgtcatgcat
gagcacaccaacgtttctggagagttcggcatgatggacatcaatgttcagcaggtccag
gtctccaatctaaagacacccatcggagtgcagaaagaagccattcttagaaccagtgac
atcgtggcttttacgcttcaagtgccgttggagaaagttccagagggttga

DBGET integrated database retrieval system