KEGG   Strongylocentrotus purpuratus (purple sea urchin): 589763Help
Entry
589763            CDS       T01019                                 

Definition
dual specificity mitogen-activated protein kinase kinase 4-like
Orthology
K04430  
mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Enzymes [BR:spu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     589763
Protein kinases [BR:spu01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   589763
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 368 aa AA seqDB search
MALANRDRDAEAGRGRLSLKLKIHTSTPNLLEKQPEINNGPSQEREQLNSMRSRSMESIG
KLSISPDETYEFTSADLEDMGEIGRGAFGSVNKMWHKQSQSIMAVKRIRSTVDEKDQKQL
LMDLDVVKRSANCVYIIKFFGALFKEGDCWICMELMDSSLDKFYRFVHEVQNTYIPENIM
GKVAYATVKALNYLKETLKIIHRDVKPSNILLDRGGNIKLCDFGISGQLVDSIARTMDAG
CKPYMAPERIDPFQSRPGYDIRSDVWSLGITMYEVATGEFPYPKWNSVFEQLSQVVKGDP
PRLKHNDKYSYSEDFISFVNKCLTKDEKYRPKYKNLLEYKFIKDYEHANIDVATFVSEIL
LAMRSTSQ
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggcgctggcaaatagagatagagatgctgaagcagggaggggacgtctgtctctcaag
ctaaagattcataccagtacacccaatctactagagaagcaacctgaaatcaacaatgga
cccagtcaggaaagggaacagttaaattcgatgagatcaagaagcatggaatcaattgga
aagttgagcatctcccctgatgagacgtacgagttcacatcggcagacttggaagatatg
ggagagattggaaggggcgcctttggttcagtcaataagatgtggcataaacagagtcag
agcatcatggcagtcaagaggatacgttcaaccgtagatgagaaggatcagaagcagctc
ctcatggatctggatgtggtgaagcgaagtgcaaactgtgtctacatcatcaaattcttt
ggtgctctcttcaaagagggggattgctggatctgtatggagctgatggattcctctcta
gataaattctacagatttgtgcacgaggtccagaacacctatataccagaaaacatcatg
ggcaaagttgcttatgcgacagtaaaagctctcaattacctcaaggaaacactgaaaatc
attcacagagacgtgaaaccttcaaatatcctgttagacaggggaggcaacatcaaactg
tgtgactttggtatcagcggtcaacttgtagactcaatagcaagaacaatggatgctggt
tgcaaaccttacatggctcctgagaggatagatcccttccagtccagacctggctatgat
atcagatcagatgtatggagtctgggaatcacaatgtacgaggtagcgacaggagaattc
ccgtaccccaaatggaacagcgtttttgagcagctctctcaggtggtcaaaggtgacccg
ccaaggttgaaacacaacgacaagtactcctactcagaagactttatatcctttgtcaat
aaatgtctcacgaaggacgagaagtacaggccaaagtacaagaatttattagagtacaaa
ttcatcaaggattatgaacatgccaacatcgacgtcgcaaccttcgtctcagagatcctt
cttgcaatgagatccacctcacaatga

DBGET integrated database retrieval system