KEGG   Strongylocentrotus purpuratus (purple sea urchin): 589998Help
Entry
589998            CDS       T01019                                 

Definition
histone H2B-like
Orthology
K11252  
histone H2B
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 123 aa AA seqDB search
MPAKTSGKGAKKAGKAKASRAAGDKKRKRRRKESYGIYIYKVLKQVHPDTGISSKAMSIM
NSFVNDVFERIAGEASRLAGYNKKATISSREIQTAVRLLLPGELAKHAVSEGTKAVTKYT
TSK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgcctgccaagactagtggaaagggagcgaagaaggccggtaaggcaaaggccagccgt
gcagcaggagataagaagaggaagaggcgccgaaaggagagctacggaatctacatctac
aaagttctgaagcaagttcaccccgacactggtatctccagcaaggccatgtccatcatg
aacagcttcgtcaacgatgtcttcgagcgtatcgccggtgaggcttcccgccttgcaggc
tacaacaagaaggccaccatcagcagccgagagatccagaccgctgtccgtctcctcctc
cccggagagctggccaagcacgccgtctctgagggcaccaaggctgtcaccaagtacacc
acctccaagtaa

DBGET integrated database retrieval system