KEGG   Strongylocentrotus purpuratus (purple sea urchin): 590047Help
Entry
590047            CDS       T01019                                 

Definition
histone deacetylase 3-like
Orthology
K11404  
histone deacetylase 3 [EC:3.5.1.98]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 432 aa AA seqDB search
MSNKTIAYFYDADVGNFHYGPGHPMKPHRLALTHNLVLNYGLYKKMQIYRPYRATAHDMC
RFHSDDYIDFLQRVTPQNIQNFTKSLSHFNVGDDCPVFPGLFDFCSMYTGASLEAATKLN
NNLCDIAVNWAGGLHHAKKFEASGFCYVNDIVIAILEILKYHPRVLYIDIDIHHGDGVQE
AFYLTDRVMTVSFHKYGNHFFPGTGDMYEVGLENGRYYSINVPLKDGIDDLMYSGLFKPV
IQSVMEFYRPSCIVLQCGADSLGCDRLGCFSLSIKGHGECVEYVKQFNVPLLVMGGGGYT
VRNVARCWTYETSLLLNDEISNELPYNDYFEYFAPDFTLHPDTTTRIENLNTKAYIDQVR
QGVHDNLKCIAHAPSVQMHDVPPDLLSLENIEEPDPDVRNSTKDQDERIEPANEFYDGDK
DQDKEDGVVLDV
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaataaaacaatagcttatttctacgatgcagacgttggaaattttcattatggt
cctggtcatcccatgaagcctcatagattagcactcacacacaatctagtactcaactat
ggcctctacaagaaaatgcagatttacagaccatacagggctacagcacacgacatgtgc
agatttcattcagatgactacattgactttttacaaagagtaacaccgcagaacatccag
aatttcaccaagagcttaagtcatttcaatgtcggtgacgactgtccagtgtttccaggt
ctctttgacttctgttccatgtacacaggagcatctttagaagcagcaaccaaactcaac
aacaatctgtgtgatattgcagtcaactgggcaggtggtcttcatcacgctaagaagttt
gaggcttcagggttctgctatgtcaatgatatcgtcattgctattttggaaatcctcaag
tatcaccctagagtgctgtacattgatatagacatccaccatggagatggggttcaagaa
gcattctacctcacagacagggtcatgacagtatcattccacaagtatggcaatcacttc
tttccgggcacaggtgacatgtatgaggttggtttagagaatggtcgctactactccatc
aatgtacctctcaaggatggcatagatgatctcatgtactctggtctcttcaaaccagtt
atacaaagtgtcatggagttctacagaccttcatgtatagtcctacagtgtggagcagac
tccttaggctgtgacagactaggttgcttcagtctcagtatcaaaggtcacggtgaatgt
gtagagtacgtcaaacaattcaatgtacccctcctggtgatgggagggggtggttacaca
gtcaggaatgtagccaggtgttggacatatgaaacatcgttattactcaatgatgagatc
agcaatgagcttccttacaatgattactttgagtactttgcaccagatttcacattgcat
ccagacaccacaacaagaatcgagaacctaaacacaaaagcatacattgaccaggtgagg
cagggggtgcatgacaacctgaagtgtatagcccacgcacccagtgtacagatgcatgat
gtacctccagatctgctcagtctagagaatatagaggaacctgacccagatgtgaggaac
agcaccaaggatcaagatgaaaggattgaaccagcgaatgagttctacgacggagacaag
gaccaggataaggaggatggtgtagtactagatgtataa

DBGET integrated database retrieval system