KEGG   Strongylocentrotus purpuratus (purple sea urchin): 590371Help
Entry
590371            CDS       T01019                                 

Definition
(RefSeq) acetyl-CoA carboxylase
  KO
K11262  acetyl-CoA carboxylase / biotin carboxylase 1 [EC:6.4.1.2 6.3.4.14 2.1.3.15]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
spu00061  Fatty acid biosynthesis
spu00620  Pyruvate metabolism
spu00640  Propanoate metabolism
spu01100  Metabolic pathways
spu01212  Fatty acid metabolism
Module
spu_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    590371
   00640 Propanoate metabolism
    590371
  Lipid metabolism
   00061 Fatty acid biosynthesis
    590371
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    590371
Enzymes [BR:spu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     590371
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     590371
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     590371
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACC_central Carboxyl_trans HD_3
Motif
Other DBs
NCBI-GeneID: 590371
NCBI-ProteinID: XP_011668415
Position
Un
AA seq 1164 aa AA seqDB search
MSSLRDPVLPLLEMQEMIASISGRVPNTVEADIRRLLNNYSSNITSVLCQFPSQQIANVL
DRYAATMLHKKAERDTFFMHTQGIVQLVQRYRNGIRGHMKAIIQEMLRHYLDVEKRFQHG
PYDKCIFALRDEFKGDMSTVFNIIYSHFQVQNKNKLVVGLIDRLSSRESGLTDELTQILS
ELTTLNKTENSKVALRSRQALIAAHQPSYELRHNQVESIFLSAIDMYGHQYCPDSLKKLI
MSETTIFDVLPDFFFHMNSVVRQAALEVYVRRAYIAYDLNCLQHAMLSNGLCFVEFQFML
PSSHPNRFLITDRGHNVPGTKSVKKKKSSSGSRGKNNRVIIKSPRSDGLPRVASIGEELM
GGYLPPCQRTGVMCAFSSIGDFEKSFDEVIDRFADMHLNFSHGVDADNNPEHNCEIDEPI
HIVNIAIQYKELKSDKDLAEMFLGFCRERKQQLFERDIRRVTFVVFQRREFPKYFTYRAR
LDFHEDHIYRHLEPALAFQLEINRMSNFDLHLMDRANYRMHLYLGSAKFIQTPPAVRDYH
AGSADHIPRPPDLHVEKGQEVTDYRFFLRAIIRHSDLVTKEASFEYLQNEAERMLLEALD
ELELAFTHPDSKRTDCNHIFLNFVPTVYMDPVKATDGLRNMISRYGTRLWKLRILQAELK
LNVKLNAHSPLLQIRIFVTNESGYRLDISTYREETDPSTGLVKFVSYGTQKGVLHGRLIN
APYMTKDHLQLKRYQAQSLGTTYVYDFPEMFRQNLAILWEQHKKQHPDVEIPEEIMIGHE
LVHDRNNELQHMNRVPGENTIGMVAWQFTFLTPEYPKGRDVVIIANDITCKIGSFGVEED
NLFQKASDHAVDKGIPRIYISANSGARIGLADEVKYLFKVAWEDPKEPEKGFKYLYLTPS
DFKKLTALNSIRAEHIEEDGESRYKISYIIGKDEGLGVENLRGSGMIAGGTSRAYEQIIT
LNMVTCRAIGIGSYVVRLGQRIVQNENSHIILTGAAALNKVLGQEVYTSNSQLGGIQIMH
NNGVTHAVSRDDFEGVGTLLKWLSYMPKTKDSLVPIIPSADPIEREIDFVPSKTPYDPRH
MLAGRPNPDKSSEWQSGFFDKGSFMEIMALWAQTVVAGRAKLGGIPVGVIAVETRSVNIE
IPADPGNPTSEAKSIAPSWNGVVS
NT seq 3495 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcgctgcgagaccctgtgctacctcttcttgagatgcaggagatgatagccagc
atctcagggcgtgtccctaacacggtggaagcagacatcaggagactcctcaataactac
agcagtaacatcacatcggtcctctgccagttcccaagtcaacagattgccaatgtgttg
gatcgctatgcagctaccatgcttcataagaaagcagaaagggataccttcttcatgcat
actcagggaatcgtgcaacttgtacaacgctatcggaacggaatccggggccacatgaag
gctatcatccaggagatgctgcggcactaccttgacgtggagaaacgcttccagcacggc
ccctatgataagtgcatctttgccctcagggacgagttcaagggggacatgtcaacggtc
ttcaacatcatctactcgcattttcaagtccagaataagaacaagctcgtcgttggactc
attgatcgtttgagcagccgtgagtcgggtctaaccgatgagctcacccagatcttgagc
gagctcaccactctcaacaagacagagaactccaaggtggctctacgatcacgccaggcc
ctgatcgccgcccaccagccatcctacgagctccgtcacaaccaggttgaatccatcttc
ctctcagccattgacatgtatggacaccagtactgccctgacagcctcaagaaactgatc
atgtctgagacgacaatctttgacgtactaccagacttcttcttccacatgaactcagtt
gtccgacaggctgcactagaggtctacgtgagacgtgcatacattgcctatgacctgaac
tgtctccagcatgcgatgctctccaatggtctctgctttgtggaattccagttcatgctc
ccatcttctcaccctaacaggttcctaatcacagacaggggccacaatgtccccggcact
aagagtgtcaaaaagaaaaagtctagctctggttccagaggaaaaaacaaccgtgtgatc
atcaagtctcccaggtcagatggcctgccgagggtggctagcataggggaggagctgatg
gggggatacttgcccccctgccagcgcaccggtgtcatgtgtgccttctccagtataggg
gactttgagaagtccttcgatgaggtcatcgaccgctttgccgacatgcatctcaacttc
tcacatggtgttgatgccgacaacaatcctgagcacaactgtgagattgatgaacccatc
cacattgtcaacattgcaatccagtacaaggagcttaagagtgacaaggatctcgctgag
atgttcctgggtttctgtcgagaaaggaagcagcaactatttgagagggacatcagacga
gtcacattcgtcgtcttccagagaagggaattccccaagtacttcacctaccgtgccagg
ctggatttccatgaagaccacatctaccggcatctagagcctgccctggccttccagctc
gagatcaacagaatgagcaactttgatctacatctcatggacagagctaactaccgcatg
catctctacctgggctcagctaagttcatccaaactcctcctgccgtgagagactaccat
gctggcagcgctgatcacataccccggccccctgacctgcatgtggagaaaggtcaagag
gtcacagactaccggttcttcctgagagcgatcatccgtcactcagacctcgtaaccaag
gaggcctcgtttgagtatcttcagaatgaggcagagaggatgctcctggaagctctggat
gaattggagctcgccttcacccatcctgattccaagcggacagactgcaaccacatcttc
ctgaactttgtacccacggtgtacatggacccggtgaaggctacagatggtctgcgtaac
atgatcagtcgctacggcacaaggctctggaaactacgcatcctacaggcagaactcaag
cttaatgtcaagctgaatgcacacagtcctctgctacagatcagaatctttgtgaccaac
gagtcagggtaccgcctggacatcagtacttaccgggaggagaccgatccatctacaggt
ctggtgaagtttgtgtcgtacggcacgcagaaaggagttcttcatggtcgactgatcaac
gctccttacatgaccaaggatcatctacagctcaagagataccaggcacagagtctgggc
acaacctacgtctatgacttcccagagatgttcagacagaacctagccattctgtgggag
cagcacaagaagcaacatcccgacgttgagattccagaagaaataatgataggtcatgag
cttgtgcatgataggaacaatgagctgcagcacatgaacagagtaccaggagaaaacact
attggtatggttgcctggcagttcactttcctcaccccagagtaccccaagggtcgggat
gttgtcatcatcgcaaacgacatcacctgcaagataggatccttcggtgtggaggaagac
aacctcttccagaaagcttcagaccatgcggtagacaaggggattccccgtatctacatc
tctgccaacagcggagcaaggattggattggctgatgaggtcaaatacctgttcaaggtc
gcatgggaagatccaaaggaaccagagaagggattcaagtacctctacctcacaccaagc
gacttcaagaagctgactgctctgaactcaatccgagcagaacacatagaagaagatggg
gaatctcgctacaagatctcatatatcataggcaaggacgaaggattaggtgttgaaaac
ctgagaggaagcgggatgattgcaggagggacatcaagagcctatgaacagatcatcaca
ctcaacatggtcacgtgcagagccataggtattggatcctacgtagtgcgtcttggtcaa
aggatcgtccagaatgagaactctcacatcatcttgaccggagcggctgcactgaacaag
gtgctaggtcaggaggtgtacacgtccaacagccagctaggagggatccagatcatgcac
aacaatggtgtgacgcatgcagtctcaagggatgactttgaaggggtcgggacgctcttg
aagtggctctcctacatgccgaagactaaggacagccttgtacccatcatacccagtgca
gatcccattgagagggagattgattttgtcccctctaagacaccatacgaccctcgacac
atgctcgctggacgtcctaacccagataagagcagtgagtggcagtctggattctttgac
aagggtagtttcatggagatcatggcactttgggcccagaccgttgtagcagggagagcc
aaattgggaggcattccagttggggtcatcgccgtggagaccaggtcagtgaacattgag
atccccgctgacccaggcaaccctacatcagaagcaaagtccattgccccaagctggaat
ggtgtggtatcctga

DBGET integrated database retrieval system