KEGG   Strongylocentrotus purpuratus (purple sea urchin): 590371Help
Entry
590371            CDS       T01019                                 

Definition
acetyl-CoA carboxylase-like
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    590371
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    590371
   00640 Propanoate metabolism
    590371
  Lipid metabolism
   00061 Fatty acid biosynthesis
    590371
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    590371
Enzymes [BR:spu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     590371
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     590371
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1762 aa AA seqDB search
VEKGQEVTDYRFFLRAIIRHSDLVTKEASFEYLQNEAERMLLEALDELELAFTHPDXXXX
XXXXXXXXXXXXXVDGGNVDGGDDDDDGGDDDGGDVDGGDDDGGDVDGGDDDGGDDDGGD
DDGGDDDGGDDDGGPVDGGNCNTITDQLMSSLRDPVLPLLEMQEMIASISGRVPNTVEAD
IRRLLNNYSSNITSVLCQFPSQQIANVLDRYAATMLHKKAERDTFFMHTQGIVQLVQRYR
NGIRGHMKAIIQEMLRHYLDVEKRFQHGPYDKCIFALRDEFKGDMSTVFNIIYSHFQVQN
KNKLVVGLIDRLSSRESGLTDELTQILSELTTLNKTENSKVALRSRQALIAAHQPSYELR
HNQVESIFLSAIDMYGHQYCPDSLKKLIMSETTIFDVLPDFFFHMNSVVRQAALEVYVRR
AYIAYDLNCLQHAMLSNGLCFVEFQFMLPSSHPNRFLITDRGHNVPGTKSVKKKKSSSGS
RIIKSPRSDGLPRVASIGEELMGGYLPPCQRTGVMCAFSSIGDFEKSFDEVIDRFADMHL
NFSHGVDADNNPEHNCEIDEPIHIVNIAIQYKELKSDKDLAEMFLGFCRERKQQLFERDI
RRVTFVVFQRREFPKYFTYRARLDFHEDHIYRHLEPALAFQLEINRMSNFDLHLMDRANY
RMHLYLGSAKFIQTPPAVRDYHAGSADHIPRPPDLHVEKGQEVTDYRFFLRAIIRHSDLV
TKEASFEYLQNEAERMLLEALDELELAFTHPDSKRTDCNHIFLNFVPTVYMDPVKATDGL
RNMISRYGTRLWKLRILQAELKLNVKLNAHSPLLQIRIFVTNESGYRLDISTYREETDPS
TGLVKFVSYGTQKGVLHGRLINAPYMTKDHLQLKRYQAQSLGTTYVYDFPEMFRQNLAIL
WEQHKKQHPDVEIPEEIMIGHELVHDRNNELQHMNRVPGENTIGMVAWQFTFLTPEYPKG
RDVVIIANDITCKIGSFGVEEDNLFQKASDHAVDKGIPRIYISANSGARIGLADEVKYLF
KVAWEDPKEPEKGFKYLYLTPSDFKKLTALNSIRAEHIEEDGESRYKISYIIGKDEGLGV
ENLRGSGMIAGGTSRAYEQIITLNMVTCRAIGIGSYVVRLGQRIVQNENSHIILTGAAAL
NKVLGQEVYTSNSQLGGIQIMHNNGVTHAVSRDDFEGVGTLLKWLSYMPKTKDSLVPIIP
SADPHDREIDFVLSKTPYDPRHMLAGRPNPDKSSEWQSGFFDKGSFMEIMAPWAQTVVAG
RAKLGGIPVGVIAVETRSVNIEIPADPGNPTSEAKDRLSSRESGLTDELTQILSELTTLN
KTENSKVALRSRQALIAAHQPSYELRHNQVESIFLSAIDMYGHQYCPDSLKKLIMSETTI
FDVLPDFFFHMNSVVRQAALEVYVRRAYIAYDLNCLQHAMLSNGLCFVEFQFMLPSSHPN
RIIKSPRSDGLPRVASIGEELMGGYLPPCQRTGVMCAFSSIGDFEKSFDEVIDRFADMHL
NFSHGVDADNNPEHNCEIDEPIHIVNIAIQYKELKSDKDLAEMFLGFCRERKQQLFERDI
RRVTFVVFQRREFPKYFTYRARLDFHEDHIYRHLEPALAFQLEINRMSNFDLHLMDRANY
RMHLYLGSAKFIQTPPAVRDYHAGSADHIPRPPDLHVLRQPLESKGLSARAINVIAASWR
ASTTKNYAVYIRKWKTYCHKKGLNYLQARSNDNGERQGTGTLSVHQLQETAQTRYYADHR
QMGEGNVDLSRDRHRHLQSSFY
NT seq 5289 nt NT seq  +upstreamnt  +downstreamnt
gtggagaaaggtcaagaggtcactgactatcggttcttcctgagagcgatcatccgtcac
tcagacctagtaaccaaggaagcctcgtttgagtatcttcagaatgaggccgagaggatg
ctcttggaagctctggatgaactggagctggccttcacccatcctgattnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnngtcgatggtgggaatgtcgat
ggtggggatgacgatgacgatggtggggatgacgatggtggggatgtcgatggtggggat
gacgatggtggggatgtcgatggtggggatgacgatggtggggatgacgatggtggggat
gacgatggtggggatgacgatggtggggatgacgatggtgggcccgtcgatggtgggaat
tgtaacacgatcactgatcagttgatgtcatcgctgcgagaccctgtgctacctcttctt
gagatgcaggagatgatagccagcatctcagggcgtgtccctaacacggtggaagcagac
atcaggagactcctcaataactacagcagtaacatcacatcggtcctctgccagttccca
agtcaacagattgccaatgtgttggatcgctatgcagctaccatgcttcataagaaagca
gaaagggataccttcttcatgcatactcagggaatcgtgcaacttgtacaacgctatcgg
aacggaatccggggccacatgaaggctatcatccaggagatgctgcggcactaccttgac
gtggagaaacgcttccagcacggcccctatgataagtgcatctttgccctcagggacgag
ttcaagggggacatgtcaacggtcttcaacatcatctactcgcattttcaagtccagaat
aagaacaagctcgtcgttggactcattgatcgtttgagcagccgtgagtcgggtctaacc
gatgagctcacccagatcttgagcgagctcaccactctcaacaagacagagaactccaag
gtggctctacgatcacgccaggccctgatcgccgcccaccagccatcctacgagctccgt
cacaaccaggttgaatccatcttcctctcagccattgacatgtatggacaccagtactgc
cctgacagcctcaagaaactgatcatgtctgagacgacaatctttgacgtactaccagac
ttcttcttccacatgaactcagttgtccgacaggctgcactagaggtctacgtgagacgt
gcatacattgcctatgacctgaactgtctccagcatgcgatgctctccaatggtctctgc
tttgtggaattccagttcatgctcccatcttctcaccctaacaggttcctaatcacagac
aggggccacaatgtccccggcactaagagtgtcaaaaagaaaaagtctagctctggttcc
aggatcatcaagtctcccaggtcagatggcctgccgagggtggctagcataggggaggag
ctgatggggggatacttgcccccctgccagcgcaccggtgtcatgtgtgccttctccagt
ataggggactttgagaagtccttcgatgaggtcatcgaccgctttgccgacatgcatctc
aacttctcacatggtgttgatgccgacaacaatcctgagcacaactgtgagattgatgaa
cccatccacattgtcaacattgcaatccagtacaaggagcttaagagtgacaaggatctc
gctgagatgttcctgggtttctgtcgagaaaggaagcagcaactatttgagagggacatc
agacgagtcacattcgtcgtcttccagagaagggaattccccaagtacttcacctaccgt
gccaggctggatttccatgaagaccacatctaccggcatctagagcctgccctggccttc
cagctcgagatcaacagaatgagcaactttgatctacatctcatggacagagctaactac
cgcatgcatctctacctgggctcagctaagttcatccaaactcctcctgccgtgagagac
taccatgctggcagcgctgatcacataccccggccccctgacctgcatgtggagaaaggt
caagaggtcacagactaccggttcttcctgagagcgatcatccgtcactcagacctcgta
accaaggaggcctcgtttgagtatcttcagaatgaggcagagaggatgctcctggaagct
ctggatgaattggagctcgccttcacccatcctgattccaagcgaacagactgcaaccat
atcttcctgaactttgtacccacggtgtacatggacccggtgaaggctacagatggtctg
cgtaacatgatcagtcgctacggcacaaggctctggaaactacgcatcctacaggcagaa
ctcaagcttaatgtcaagctgaatgcacacagtcctctgctacagatcagaatctttgtg
accaacgagtcagggtaccgcctggacatcagtacttaccgggaggagaccgatccatct
acaggtctggtgaagtttgtgtcgtacggcacgcagaaaggagttcttcatggtcgactg
atcaacgctccttacatgaccaaggatcatctacagctcaagagataccaggcacagagt
ctgggcacaacctacgtctatgacttcccagagatgttcagacagaacctagccattctg
tgggagcagcacaagaagcaacatcccgacgttgagattccagaagaaataatgataggt
catgagcttgtgcatgataggaacaatgagctgcagcacatgaacagagtaccaggagaa
aacactattggtatggttgcctggcagttcactttcctcaccccagagtaccccaagggt
cgggatgttgtcatcatcgcaaacgacatcacctgcaagataggatccttcggtgtggag
gaagacaacctcttccagaaagcttcagaccatgcggtagacaaggggattccccgtatc
tacatctctgccaacagcggagcaaggattggattggctgatgaggtcaaatacctgttc
aaggtcgcatgggaagatccaaaggaaccagagaagggattcaagtacctctacctcaca
ccaagcgacttcaagaagctgactgctctgaactcaatccgagcagaacacatagaagaa
gatggggaatctcgctacaagatctcatatatcataggcaaggacgaaggattaggtgtt
gaaaacctgagaggaagcgggatgattgcaggagggacatcaagagcctatgaacagatc
atcacactcaacatggtcacgtgcagagccataggtattggatcctacgtagtgcgtctt
ggtcaaaggatcgtccagaatgagaactctcacatcatcttgaccggagcggctgcactg
aacaaggtgctaggtcaggaggtgtacacgtccaacagccagctaggagggatccagatc
atgcacaacaatggtgtgacgcatgcagtctcaagggatgactttgaaggggtcgggacg
ctcttgaagtggctctcctacatgccgaagactaaggacagccttgtacccatcataccc
agcgcagatccccatgacagggagattgattttgtcctttcaaagacaccatacgaccct
cgtcacatgcttgctggccggcctaacccagataagagcagtgagtggcagtcaggattc
tttgacaagggaagcttcatggagatcatggcaccttgggcccagaccgtggtggcaggg
agagccaaattgggaggcattccagttggggtcatcgccgtggagaccagatcagtgaat
attgagatccctgctgacccaggcaaccctacatcagaagcaaaggatcgtttgagcagc
cgtgagtcgggtctcaccgacgaactcacccagatcttgagcgagctcaccacactcaac
aagacagagaactccaaggtggctctacgatcacgccaggccctgatcgccgcccaccag
ccatcctacgagctccgtcacaaccaggttgaatccatcttcctctcagccattgacatg
tatggacaccagtactgccctgacagcctcaagaaactgatcatgtctgagacgacaatc
tttgacgtactaccagacttcttcttccacatgaactcagttgtccgacaggctgcacta
gaggtctacgtgagacgtgcatacattgcctatgacctgaactgtctccagcatgcaatg
ctctccaatggtctctgctttgtggaattccagttcatgctcccatcttctcaccctaac
aggatcatcaagtctcccaggtcagatggcctgccgagggtggctagcataggggaggag
ctgatggggggatacttgcccccctgccagcgcaccggtgtcatgtgtgccttctccagt
ataggggactttgagaagtccttcgatgaggtcatcgaccgctttgccgacatgcatctc
aacttctcacatggtgtcgatgcagacaacaatcccgagcacaactgtgagatcgatgaa
cccatccacattgtcaacattgcaatccagtacaaggagcttaagagtgacaaggatctc
gctgagatgttcctgggtttctgtcgagaaaggaagcagcaactatttgagagggacatc
agacgagtcacattcgtcgtcttccagagaagggaattccccaagtacttcacctaccgt
gccaggctcgatttccatgaagaccacatctaccggcatctagagcctgccctggccttc
cagctcgagatcaaccgaatgagcaactttgatctacatctcatggacagagctaactac
cgcatgcatctctacctgggctcagctaagttcatccaaactcctcctgccgtgagagac
taccatgctggcagcgctgatcacataccccggccccctgacctgcatgtgctgcgccag
ccactagaaagtaaaggtttgagtgcaagagctatcaatgtaatagcagcatcgtggcga
gcatcaacgacaaagaactatgccgtttacataaggaaatggaagacatactgccataaa
aaaggcttgaactatctccaggcgagatccaatgataacggagagcgtcaggggacagga
acgctatctgttcatcagcttcaagaaaccgcacaaacgcgttactacgcagaccatcgc
cagatgggtgaaggaaacgttgacctcagcagggatcgacacagacatctacaaagctca
ttctactag

DBGET integrated database retrieval system