KEGG   Strongylocentrotus purpuratus (purple sea urchin): 590792Help
Entry
590792            CDS       T01019                                 

Definition
ubiquitin carboxyl-terminal hydrolase 36-like
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Enzymes [BR:spu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     590792
Peptidases [BR:spu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   590792
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 324 aa AA seqDB search
MTIDDTLRRDLFKSKAKSGDREGSGTKAYDIDLDKHLVSSSKQVLLKHVDFQAAQKDISF
RLQNLRGKYVPLNAAKSNLQGEGSKKSQGYSHKGKMSLQDESQSKSDGIPAPKQVLYKPE
RVRLDWQKCNRVGSGLINMGNTCFLNSTLQCLTYTAPLANYLLSHQHKEECRSYGFCILC
DLYTHIQRAFQHPNQAIRPMNMIHKLKSIAKHMHIGRQEDAHEFLRYVIEAMQKSCLSGY
DNKLNRYSKETSPVHQIFGGYYRSRVICAACQSKSDTFDPFLDISLDIKVLGSILASAYI
LGQGFLPTFVPLHPGVHRYLAMRE
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgacgatagacgacactctgcggcgagaccttttcaagtctaaggccaagtctggtgat
cgagaagggagcgggacaaaggcttatgacattgacttggacaagcacctggtgtcttct
tcgaaacaggtactattgaagcatgtagatttccaggcagcacagaaagacatttcgttt
cgtctccagaatctgcgagggaaatatgtcccactgaatgcagcgaagtcaaacttacag
ggtgaaggctctaagaagtcccaaggatattcacacaaaggcaagatgagccttcaggat
gagagccaaagcaagtcggatggcatcccggcacccaagcaggtgctctacaagccggag
agggtgcggctggactggcagaagtgcaaccgggttggcagcggcctcatcaacatgggc
aacacctgtttcctcaactccactctgcagtgcctgacctacacagcccctctggcgaac
tacctgctcagccatcaacacaaggaggagtgtcgatcatatggtttctgcatcctgtgt
gacctctacacacacatccagcgtgccttccagcatcccaaccaagccattagacccatg
aacatgatacacaaactcaaaagtatagccaagcacatgcatataggacggcaggaagac
gcacacgagttcctacgctatgtcatagaagcaatgcagaagtcctgtcttagtggatat
gataataaactgaataggtacagcaaggaaaccagtcccgtccatcagatattcggaggc
tactacagaagcagagtgatatgtgcagcatgtcagagtaaatcagatacctttgaccct
tttttggacatcagtctggacatcaaggtcctgggttccatcctcgctagtgcttacatc
cttggacaaggctttttgcccacatttgtcccactccaccccggtgtacataggtacctg
gcaatgcgggagtaa

DBGET integrated database retrieval system