KEGG   Strongylocentrotus purpuratus (purple sea urchin): 590811Help
Entry
590811            CDS       T01019                                 

Definition
calcineurin subunit B type 2-like
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Wnt signaling pathway
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:spu04310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 170 aa AA seqDB search
MGNDVTLPMEMCSNFDADEIRRLGKRFKKLDLDNSGSLSVDEFMSLPELQQNPLVQRVID
IFDEDGNGEVDFKEFIQGVSQFSVKGDKESKLKFFFRIYDMDRDGFISNGELFQVLKMMV
GSNLKDTQLQQIVDKTITNADLDGDGKISYDEFCTVVANTDIHQKVVVDV
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggtaatgatgtcacactaccgatggagatgtgctccaactttgatgcggatgagatc
cgtaggctggggaagcgtttcaagaagctggatctggacaactcgggttccctgagcgta
gacgagttcatgtcattaccggaactccagcagaatccactggtccaaagggtcattgat
atatttgacgaggacgggaacggggaggtagatttcaaagagttcatccagggtgtttca
caattcagtgtgaagggagacaaagaatcaaaacttaaattcttctttaggatctatgac
atggaccgggacggtttcatctcaaacggggagctgttccaggtcttgaagatgatggtg
gggtcaaacctcaaggacacgcaactgcagcagatcgtagacaagaccatcaccaacgca
gacttggacggggacggcaaaatatcctacgatgaattctgcactgttgttgcaaatacc
gacatccatcagaaagtggtcgttgatgtatag

DBGET integrated database retrieval system