KEGG   Strongylocentrotus purpuratus (purple sea urchin): 591055Help
Entry
591055            CDS       T01019                                 

Definition
(RefSeq) mRNA export factor
  KO
K14298  
mRNA export factor
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:spu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    591055
Messenger RNA biogenesis [BR:spu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     591055
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 368 aa AA seqDB search
MFGTSTAFGASSSGVFGQTNTSGTHNPMKDIEVTSPPDDSISSLRFSPASIPNTFLIAGS
WDNNVRCWEIQSSGQTIPKAQQTHTGPVMDVDWHDDGTKVFTASCDNTAKMWDLNSNQAI
QIAQHDGPIKSIRWVKAPNYSCVMTGSWDKTIKFWDTRQPNPILSIQLPERCYCADVMYP
MAVVGTADKNVIIYQLENQPSEFRRMDSPLKYQLRCLAIFKDTKKNAPTGFALGSIEGRC
AIQFVQAANPKDNFTFKCHRTNGASYNSQDIYAVNSIAFHPEYGTLATCGSDGKFSFWDK
DARTKLKTSEQMEQPITCAAFDAKGQIFAYAVSYDWSRGHEFYNPQKKNYIFLRGNATEE
LRPRNRRR
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgtttgggacgtccacagccttcggcgccagctcgtccggtgtgttcggccagaccaac
acgtcaggaacgcacaacccgatgaaagacatcgaagtcacctctccaccggatgatagc
atcagctccttacgattcagcccagcttcgatcccaaacacattcctcatcgctgggtca
tgggataacaatgttcggtgctgggagatccagagcagtggtcagactatccctaaggct
caacagactcacactggtcctgtcatggatgtagattggcacgatgatggcacgaaagta
ttcacagcttcttgtgacaacacagccaagatgtgggatctcaacagtaatcaggccatt
caaattgcacagcatgacggacccatcaagtccatacgctgggtcaaagcaccaaactac
tcctgtgtcatgacaggcagctgggataaaaccatcaagttctgggatacccgacaaccg
aaccccatcctaagcatccagcttccagagaggtgctattgtgctgatgtgatgtacccg
atggccgtagtgggcacggctgacaagaacgtcatcatctaccaactagagaaccagcct
tcagaattcagacggatggattcaccactcaaatatcagctgagatgccttgccatcttc
aaagacacaaagaagaacgcaccaacagggtttgccttgggtagcatcgagggaagatgt
gcaatccagtttgtgcaggcagccaacccaaaagacaactttaccttcaaatgccacagg
accaatggagcctcatacaacagccaagatatctatgcagttaactcaatagcattccac
ccagagtacggcacactagctacatgtggctcagacggcaagttcagtttctgggacaag
gatgctaggacaaaactgaagacgtcagaacagatggaacagccaatcacatgtgccgct
tttgatgccaagggtcagatatttgcatacgccgtcagctatgattggtcaaggggacac
gagttctacaacccacagaagaagaactacatcttcctgcgaggaaacgccacagaggaa
ctacgcccaagaaatagaaggaggtag

DBGET integrated database retrieval system