KEGG   Strongylocentrotus purpuratus (purple sea urchin): 591055Help
Entry
591055            CDS       T01019                                 

Definition
(RefSeq) mRNA export factor
  KO
K14298  mRNA export factor
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
spu03013  RNA transport
Module
spu_M00427  Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:spu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    591055
Messenger RNA biogenesis [BR:spu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     591055
Chromosome and associated proteins [BR:spu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    591055
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 eIF2A ANAPC4_WD40 Nup160 Me-amine-dh_H Exonuc_X-T_C WD40_like
Motif
Other DBs
NCBI-GeneID: 591055
NCBI-ProteinID: XP_011669260
Position
Un
AA seq 368 aa AA seqDB search
MFGTSTAFGASSSGVFGQTNTSGTHNPMKDIEVTSPPDDSISSLRFSPASIPNTFLIAGS
WDNNVRCWEIQSSGQTIPKAQQTHTGPVMDVDWHDDGTKVFTASCDNTAKMWDLNSNQAI
QIAQHDGPIKSIRWVKAPNYSCVMTGSWDKTIKFWDTRQPNPILSIQLPERCYCADVMYP
MAVVGTADKNVIIYQLENQPSEFRRMDSPLKYQLRCLAIFKDTKKNAPTGFALGSIEGRC
AIQFVQAANPKDNFTFKCHRTNGASYNSQDIYAVNSIAFHPEYGTLATCGSDGKFSFWDK
DARTKLKTSEQMEQPITCAAFDAKGQIFAYAVSYDWSRGHEFYNPQKKNYIFLRGNATEE
LRPRNRRR
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgtttgggacgtccacagccttcggcgccagctcgtccggtgtgttcggccagaccaac
acgtcaggaacgcacaacccgatgaaagacatcgaagtcacctctccaccggatgatagc
atcagctccttacgattcagcccagcttcgatcccaaacacattcctcatcgctgggtca
tgggataacaatgttcggtgctgggagatccagagcagtggtcagactatccctaaggct
caacagactcacactggtcctgtcatggatgtagattggcacgatgatggcacgaaagta
ttcacagcttcttgtgacaacacagccaagatgtgggatctcaacagtaatcaggccatt
caaattgcacagcatgacggacccatcaagtccatacgctgggtcaaagcaccaaactac
tcctgtgtcatgacaggcagctgggataaaaccatcaagttctgggatacccgacaaccg
aaccccatcctaagcatccagcttccagagaggtgctattgtgctgatgtgatgtacccg
atggccgtagtgggcacggctgacaagaacgtcatcatctaccaactagagaaccagcct
tcagaattcagacggatggattcaccactcaaatatcagctgagatgccttgccatcttc
aaagacacaaagaagaacgcaccaacagggtttgccttgggtagcatcgagggaagatgt
gcaatccagtttgtgcaggcagccaacccaaaagacaactttaccttcaaatgccacagg
accaatggagcctcatacaacagccaagatatctatgcagttaactcaatagcattccac
ccagagtacggcacactagctacatgtggctcagacggcaagttcagtttctgggacaag
gatgctaggacaaaactgaagacgtcagaacagatggaacagccaatcacatgtgccgct
tttgatgccaagggtcagatatttgcatacgccgtcagctatgattggtcaaggggacac
gagttctacaacccacagaagaagaactacatcttcctgcgaggaaacgccacagaggaa
ctacgcccaagaaatagaaggaggtag

DBGET integrated database retrieval system