KEGG   Strongylocentrotus purpuratus (purple sea urchin): 591055Help
Entry
591055            CDS       T01019                                 

Definition
mRNA export factor-like
Orthology
K14298  
mRNA export factor
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:spu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    591055
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 368 aa AA seqDB search
MFGTSTAFGASSSGVFGQTNTSGTHNPMKDIEVTSPPDDSISSLRFSPASIPNTFLIAGS
WDNNVRCWEIQSSGQTIPKAQQTHTGPVMDVDWHDDGTKVFTASCDNTAKMWDLNSNQAI
QIAQHDGPIKSIRWVKAPNYSCVMTGSWDKTIKFWDTRQPNPILSIQLPERCYCADVMYP
MAVVGTADKNVIIYQLENQPSEFRRMDSPLKYQLRCLAIFKDTKKNAPTGFALGSIEGRC
AIQFVQAANPKDNFTFKCHRTNGASYNSQDIYAVNSIAFHPEYGTLATCGSDGKFSFWDK
DARTKLKTSEQMEQPITCAAFDAKGQIFAYAVSYDWSRGHEFYNPQKKNYIFLRGNATEE
LRPRNRRR
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgtttgggacgtccacagccttcggcgccagctcgtccggtgtgttcggccagaccaac
acgtcaggaacgcacaacccgatgaaagacatcgaagtcacctctccaccggatgatagc
atcagctccttacgattcagcccagcttcgatcccaaacacattcctcatcgctgggtca
tgggataacaatgttcggtgctgggagatccagagcagtggtcagactatccctaaggct
caacagactcacactggtcctgtcatggatgtagattggcacgatgatggcacgaaagta
ttcacagcttcttgtgacaacacagccaagatgtgggatctcaacagtaatcaggccatt
caaattgcacagcatgacggacccatcaagtccatacgctgggtcaaagcaccaaactac
tcctgtgtcatgacaggcagctgggataaaaccatcaagttctgggatacccgacaaccg
aaccccatcctaagcatccagcttccagagaggtgctattgtgctgatgtgatgtacccg
atggccgtagtgggcacggctgacaagaacgtcatcatctaccaactagagaaccagcct
tcagaattcagacggatggattcaccactcaaatatcagctgagatgccttgccatcttc
aaagacacaaagaagaacgcaccaacagggtttgccttgggtagcatcgagggaagatgt
gcaatccagtttgtgcaggcagccaacccaaaagacaactttaccttcaaatgccacagg
accaatggagcctcatacaacagccaagatatctatgcagttaactcaatagcattccac
ccagagtacggcacactagctacatgtggctcagacggcaagttcagtttctgggacaag
gatgctaggacaaaactgaagacgtcagaacagatggaacagccaatcacatgtgccgct
tttgatgccaagggtcagatatttgcatacgccgtcagctatgattggtcaaggggacac
gagttctacaacccacagaagaagaactacatcttcctgcgaggaaacgccacagaggaa
ctacgcccaagaaatagaaggaggtag

DBGET integrated database retrieval system