KEGG   Strongylocentrotus purpuratus (purple sea urchin): 591084Help
Entry
591084            CDS       T01019                                 

Definition
(RefSeq) histone-lysine N-methyltransferase 2C
  KO
K09188  
histone-lysine N-methyltransferase MLL3 [EC:2.1.1.43]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    591084
Enzymes [BR:spu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     591084
Transcription factors [BR:spu03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    591084
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 4941 aa AA seqDB search
MSGRRKRLGHKPESEVSMDVESIPQRRGRGRPKRETFNVNERRKGLRVEGGSEEEPTDLA
ITMDTTLSNLEVEPSSNKLNLDNESPEEEEEEEPEDDDPGDMSHMIDHSESQLVERTCSD
QSLVKSLDSYSAATDSGVTSPELSHRGVSPGHTGGYGGSLMDENQYDDDVMDCNNGSSDP
SCSLCCCGERSLLGQGDLLRFDSTPGFNPFRKPLPRSRRNYEEDAPYNPNESRSQKHLTW
RRARGPPKAHKHGLGDRSKSPRRSNPDSIKDPSLDGLDELSHVGHADEPDLQTLFELAGH
TTAHHCCAAWSDGVCQNENFQLLNVDKAVFSGITQRCSYCHRFGATIFCVEQGCNRVYHY
PCAASSGSFQGIKSLILLCPEHLDLAEERVEMEELECAICDLPGNLSESLFCTSCGQHYH
GSCLDPPVSIDPVVRAGWQCPNCKICQTCRQPGDDNKMLVCDTCDKGYHTFCLKPAMITI
PKNGWKCKTCRVCTDCGARTPGNGPSSRWHHNYTVCDSCYQQRNKGYCCPICGKAYRHHT
THKVMVQCHLCNRYVHADCDDRTVISKYQQSKAAGQPTPYKCPDCRHRPNRGLELERRRS
ASPFEDGRRSPFASSSRTPPHLPIPDDTSQDLSLSASSVQEDSLSLSSIDTDYTMASDDR
RPELQQEFSASLSGSSGLSMTIASVTRHHGGGKPLDRLSQLERMGRRRFSGRPRGRGSSS
YAAVGRRRRQGGGGNVGGRRGPKPKIKIAAIQPASPPPEDELELIDPVVVEKPSAKEKDE
EDTSMHSTVVLFSVDDKFTATQDMCLSCGSFGLGSEGRLLTCSQCGQCYHPYCVSIKITK
VVLSKGWRCLDCTVCEGCGKSSDEARLLLCDDCDISYHTYCLDPPLQTVPKGGWKCKWCV
CCTHCGSVTPGENADWMNNYTQCGPCASMTHCAYCYRSYRDNELLCQCSHCQRWEHALCN
SLYTEDETERAMDKGFICTLCRPFLPEPEPQLPEPSTEEPPQRIPKLAIKEPELHNKEFS
VEGVRLTETGFKQISSMAMARTHKKSKKVRSSLKMGSLAILRSLADPHSDISKIADQEYD
PEGIERVDPEKWRGFSHGEKNDSSVGEGKHHHHHHHHHHDKKKSKHRSSLRPGIGGFIAK
PRGFHSHKENRIAAMSRSMSEGASDTMDSIRDQSELLQRTHSVGEEGHYEKSKKRKRAHK
RSQLENQFPSYLQVCEAFFGKMLLNSSKDQPTMNTRLDISDEDSKKHSSSHHQSKGTEII
KVSSAEHKSSLSAGSSRQTHHNQADVHRESAATVDGAAGVLGSGEDPLNFLPQDELLGML
IGDGLGKNGENLDIDSIDAEATHSSTTGQNGHTTQASSSSDHLNELDSLLSYNLHIVPED
LAHIDSKEVEDLFSGVLSPEGHHHAGSTNTPTSGVDGNATNTATPSTVSQQQHQHHHHHH
QQQQLQKQPLPHLPLTQQLVQAASVGHSVASPAFSPDFAEPPSPWPGGGGGGETDGETLS
YNQRNIKKWEKDEPLGNQATISPVLYANINYPDLKKDFPDWPSRAKQIAKLWRKAGSGNK
KPFLQLARENRAAQRIKEAQKIHQQKRQKFDGDLMSDGQDGSGIRPSQQQQLQQGQQPST
PIPQAQRSPKSMPGTPIPGTPMSPATEMPHSSLMNANSQALSGHSGLPVHMPLSNQSSGA
VNMDSMPPSPMVAQPSNIHLQSGRSGTPSMIPGRSPHHSEEISHGVMGGVNTHQQHLASL
IAGQGAPPTSSSDHLPVSNNQSIIDRLQSPGMPHGSASQVPPGIGNMSPAHAMSVGSPAH
VMSVGSPAHAMPVDMPIHSPQQAPFMKNPVFPDGASNQSLSPAASAAPADRVGMNDGNKH
AQKQYIRQLLVRQQEKKRMRREQQQMQNQNWSGESHQRPPPPYPANAPSDQISPATNNEQ
MNSFPGTPGMPRPEAPPSFVNQRPQEQFNMTLEQTDEAWRQGQFATGLQRRPSDGGNRIP
GPGQFIELRRFEQGARMPVSGPTLSPRPRNIALLQEKLHQRALQQRTALVGSNPLDPYDH
MVRQQAHSRTPTPRQVMTHPNFHGRSPMMSPIVDHPAQQPHLPFQQPTPPFQGQNTNAIQ
NHQPRIHNAMPAQQPGTLQSDLHLPPGQDPAMAPQQEDHDAQLEDLLSGELDLIDFAGTD
LDTNKHSAENQQLFKDFGLSDEALDEMTTSSNTPKDSNSSKIENGIPSAAPENNEVQSTS
TAGASLEKESDKVPEDKPAANEPKQTDSSGLPADPNKKEETSSSGRKDAPKTGRDISATV
SSNTSEESSSKGLMNHDDKSATQSQGTNISSDKGSKEKTVVHTDITNTSASVPTVPLSTS
ASVLQTSTSVPVSASPSEALTTSTTFLGKATIKIEATENSQSICQRSKVLTAQSGQLTTT
IIGSQLVEKPQSHSQGLQDKASPGTSSVETKTTLSSSVSAPRGGVPTIDQIAAILPGPAS
NIQSNSTSQLPVASVASQPTTSDGTQLQTSQSSGSAHTNSLQKRQRLLHEQPLLLQDLLE
KEKREQQKLQQQSGNVEAAISGKVDPKSKTQGSDPFLDNLDLERLQAEAKMIAKETEDFT
IKPPGPHAQLLLAMNRQYHVQMQQRHLTEQQPGANVPLIPPASPGIRQPRTPQGVDFGSI
DSVKDPIRSNSTDLFKQGQTVPPQGMQGMSHMNAHGQEMGPFSPGHPQMPNFSPGPRFSA
HENIQTHPSPGPVSPMSPMTQNHFGMRPRGPMVVQNSGIVGRPPMPGSGMHMQGGLPGDQ
MPMQMHGMQRLPGPGQRMGMPVMNRMPGPPQVSNFRFPGRFMSPNMQRMPSPFFNVGMDG
MSHAMMNFDPYDTTEEKAPEDTSTPEYEEWIFNKDRKLQLRLKFFENEVGKERKKKKALT
SRQRACRKNNKVFPESDRLELEAVQQRHSKQQKFLENVRKQQRQHAILLQEFRMKQQQKL
SSNHSPLGHHNPMMQGMMSPQGMMMQGQGPNPGMHSSMIGGQQHTLIPPGGTSPNIPQQM
LINQGMQSPSGSMMQGPQSGMMPQGQMMGHVSQQIPHPMRSPMSGERPPFAVRSGQQSPM
MHGNQIMQPGNAGMMVMPGQTSPMVSNAIMQGSNPMSQASMMPNNRQPSPLMPGSNPQTP
MMPGNKPPTSMIPINSPQTMGMPGGNQTNMLPGGMNMPRGTNPQQIPVQPSQQSPMSHPS
HQVSIGASSQQQSPMSAQSPMVPQSPMVPQSPMVPQSPMVPHSPMVPHSPMVPQSPMVPH
SPMVPHSPMVPHSPMVPHSPMVPHSPMVPHSPMVPQSPMVHPGQQSPVVSSGQQQSPMMG
HQSQQNSPAVQNSEHSPLNAGSHQSPAVTPGVPSPMVPPGAQSPMMPPGGQSPLKQAGQQ
SPMVLADQQSPMVSQGQSSGPNSSHPSPMMPPPSPMMTHPGQQSPIASSANQGPTPSVSG
QIQMRQAGTPMQSPLQSPISAKTLPQLSPIDKRMPINIGQDNNPFSETFQQRERMERLRE
QHERQRLQLAQELEHVRAMQRYEQQQQHQQQQQHQQLNTSHVFNPSRLPGPHQVQQQGNM
GQFSQMPNPGMVSPISQVPPVHNSSVGIRPPFPSPQAPLQSPVQSPFPREPLQPGMMSSQ
SSTPTTEGFPMPPSYPGMQTKVQKPKKKRAKKKTSDLFNPNPTSVHQSPVGVLDESSVMA
AIGHSQEKGGMVMSVQNILQLTSPGSATHQALQSIMANDPTASVDLAKLQQSQAMLMIGD
INAKAAKDGILKNNHNQLLKQLLQGPSICASGIVKSVPNKTPVQNQLIKVTGETSNAESI
QTQQHYDSSVDMHDEEGPIRLTSEQQKQLEIIEQLPYVKKDGKPAENDLQILLEIHRQGK
IDYPPPQEPKEKVPAPPVIPASPQPTVKQHKHKEKKKHKEKKSKKNKESRFSSVEELMAA
LKQMPMLQLTEPEVGVNFSLCPLFGSGTTNGGTRLRGAFGHAILDGVPDFYDHLLTGSTS
DTKLKLPLGVVNGPSSLKEIGSKAQGDEVMREMQSHQRTITRTMNHAYSGGGGLAHLVAP
SPSLSQVVADIVISSSPECEENEAQEPSKMKGLRLFTQDVDQVLAAQKRSGSPTIPIIKP
TPRKAEAGSLGNANTVQVTLKLMPEVMHNVEGVLSAFSKLLGIKEPSNFEVIDEAGQKER
RGKWAQSTSPVADVALKISPEKISASPTSLTTSVKPTKITSKSSVLAGSLDDPKLHFCRH
CDVLVVGEGVRKSATPTDKNVVFCSGACYLQHTISLRSQVARTEVNAGRVVNHRSSDPQS
VQLDVLSPKASTSLPTSPCTVPKTPPQSKSTPISPRSLPAQPVVSSPMAAQPAHTSAEGT
TATPSSNQEVSPAKEEKMVTDADEMKVIISESKTGESGREELRLTLKTGTRRRPALGDEL
PLVKKWKNIKWRRWHGSFSGGKKYRPPSDQDIGQLIKKLGTSMRTSETLRDARCCVLCNG
FGDGDTNGSARLLNLNVDTWVHLNCALWSDEVYETLNGSLMNVESALKRGRTCTCCYCSK
LGATISCNKQRCCNVYHFSCAMQDHCMFFKDKTMMCPLHAPSKPTESTLQSHVVFRRVYI
SRDEHKQVANIMTMADRKYTVRVGSLIFKSLGQLLPHQMHLFHSLTSIYPVGYESIRLYW
SMRYTNKRCSYSCTIQDQGGRPEFSIRIMEQGHEDIIFRADTPRNVWYKVLEPIAKLRRD
ADMLKVFPTFLTGEDLFGLTEAAIQRITESLPGVDLIQHYTFRFGRSPLIDLPLAVNPTG
CARAEPRRQTHLKRPHTLTSNKTSRGFHTTLAGEVASPYNKQFVHSKSSQYKRLKTEWKT
NVYLARSQIQGLGLYAAHDIEKHTMVIEYIGTLIRNEVANKWERDYEAANRGVYMFRIDD
YTVVDATRSGNPARYINHSCNPNCVAEVVNFDKDQKKIIIISSRRLLKGEELTYDYKFEI
ENDQNKIPCLCKAPNCRKWMN
NT seq 14826 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggacgcaggaaaagacttggccataagccagaatcagaggtctccatggatgtg
gaaagcattccacagagaagaggaagaggccggccgaaacgtgaaacattcaatgtcaat
gaaagacggaaaggcctcagagtggagggtggaagtgaagaggagccgacagatcttgca
ataactatggatacaactctcagtaacttggaggtggaaccctcctccaacaaactaaac
ttggacaatgaatcaccagaggaggaggaggaggaggaaccagaggacgatgaccccggg
gatatgtcgcatatgatcgaccattcagaatcacaattagtggaaagaacttgtagcgac
cagtcgctggtcaagtctttggattcttacagtgctgcaacggacagtggggtaacgtcc
cctgagctgagtcatagaggggtcagccccgggcatacagggggttatgggggtagtctg
atggatgagaaccagtatgacgatgatgtgatggattgtaataatggtagcagtgatccg
agctgttccctctgctgttgtggtgagcgtagcttgctagggcagggggatctactgcgg
ttcgactctactccgggattcaaccccttcaggaaacccttgcccaggtccagacggaac
tatgaagaggatgctccttataatcctaacgagagcaggagccaaaagcatctcacatgg
agacgagctcggggacctcctaaggcacataagcatggacttggggatagaagtaaatca
cctcgtaggagtaatcctgattctatcaaggatccatcattagacggcttggatgaattg
agtcatgtaggccatgctgatgaaccagatctccaaactctctttgaattggcaggtcac
acaacagcacatcactgctgtgctgcctggtcagatggtgtgtgccaaaacgagaacttt
caactcctcaacgtagataaggctgtattctcagggatcactcagcgctgcagttactgt
cacaggtttggagccaccattttctgtgtggagcaaggttgtaacagggtctatcactac
ccatgtgctgcaagcagtggttcctttcagggtatcaagtctcttattctgttgtgtcca
gaacatctggatttagcagaagagagggttgagatggaggagttagaatgtgccatctgt
gacctgcctggcaatctctcagagtcattattctgcactagttgtggacaacactaccat
ggctcttgccttgatccacctgtctccattgaccctgttgtcagggcaggctggcagtgc
ccaaactgtaagatctgccaaacttgcaggcaacctggggatgataacaagatgcttgtg
tgtgatacatgtgataagggctatcacacgttctgcctgaaaccagccatgattaccatt
ccaaagaatggctggaaatgcaaaacctgtcgggtatgcacagattgtggtgcaaggacg
ccgggaaacggtcccagctcaaggtggcatcacaactacaccgtctgtgatagctgctat
caacaacgcaacaagggctactgctgtcccatctgtggcaaggcatacaggcatcatact
acgcacaaagtcatggtccaatgtcatctctgcaataggtatgttcatgctgactgtgat
gacagaacagtaataagcaagtaccagcagagcaaggcagcgggccagcccacaccctac
aagtgtccagactgtcgtcatagaccaaacagaggactggaactggagaggagaagatcg
gcaagcccctttgaagatgggagaagaagtccctttgcatccagctcaagaacacctcct
catcttcctattccagatgacacatcgcaagacctgtcattgagtgcatccagtgttcag
gaggatagtctgagtctgagtagtatcgacacagattacaccatggcatcggatgataga
aggccagagttacagcaggagttttcagcatctctatcaggatctagtgggttgtccatg
accattgcctctgtcaccagacaccatggaggaggcaaacctctggatagactcagtcag
ctggagaggatgggacgaagaagattcagtggcaggccaaggggaagaggcagtagtagc
tatgcagctgtagggaggaggagaaggcaaggaggagggggtaacgttggcggcaggaga
ggtcctaaacccaagatcaagattgctgccatacaacctgcatcaccaccacccgaagat
gagttagaattgatagatcccgtggttgttgagaagccttcagcaaaggagaaggatgag
gaagatacctccatgcatagcactgtggtcctcttctccgtggatgacaagttcactgca
actcaggacatgtgtttgagctgtggcagctttggtcttggatcagaagggagattacta
acgtgttctcaatgtggccagtgttatcacccttactgtgtcagcataaagatcacgaag
gttgtattatccaagggctggagatgtctagactgtactgtgtgtgaaggatgtggcaag
tcaagcgatgaggctaggttattactgtgtgatgattgtgatatcagctatcacacctac
tgtctagatccaccattgcagactgtgcccaaaggtggatggaaatgcaaatggtgtgtc
tgctgcactcactgcgggtcagtgacgcctggggagaatgctgactggatgaacaactac
actcagtgtggaccttgtgccagcatgacacactgtgcatactgctacaggagctacaga
gacaatgaactcctctgccaatgttctcactgtcaaaggtgggagcatgctctttgtaac
agtttgtacactgaagatgaaacagagagagccatggacaagggctttatctgtacccta
tgcagacccttccttcctgaaccggaacctcagcttccagaacccagtaccgaggaacca
cctcagagaatacccaaactagcaataaaagaaccagaactgcataataaagagttctct
gtagaaggtgttcgtttgacagagacgggcttcaagcagatcagtagtatggccatggct
cgcacgcacaagaaatccaagaaggtcagatcaagtctcaagatgggcagcctggccatc
cttcgaagcttggctgatcctcactcagacatctccaagatcgctgatcaggaatacgac
ccagaaggtattgaaagagtagatccagagaagtggagggggtttagccatggagagaaa
aatgatagtagtgtaggtgaggggaagcatcatcatcaccatcatcatcatcatcatgat
aagaagaagtcgaaacacagatcatcattacgaccaggtattggaggtttcattgccaag
ccaaggggctttcactctcacaaagagaaccgaattgcagccatgagtagaagtatgtca
gaaggggcttcagataccatggattcaatacgggatcaatcagagcttctccagagaact
cattcagttggagaagaaggtcactacgagaaatcaaagaagaggaaaagagctcacaaa
agaagtcagctggagaaccagtttccatcatatcttcaggtatgtgaggcattctttgga
aagatgctactaaactcaagcaaagatcagcctaccatgaacactaggctagacatctca
gatgaagacagcaaaaagcattcatcatcacaccaccagagtaaaggtactgaaataatc
aaagtctcctccgcagaacacaagtcatcgttgagtgcaggctcatccagacagacccat
cacaaccaagcagatgtacacagagaatctgcagcaacggtagatggtgcagcaggagtc
cttggttctggtgaagatcctctcaacttcttgcctcaagatgaactcctgggtatgcta
ataggagatggtctcggaaagaatggtgaaaacctggatattgatagcatcgatgcagaa
gctacacattctagtacgaccgggcagaatggacacacaactcaagccagctcatcttca
gatcacctcaatgagctcgattcgttgctttcatataacctacacattgttcctgaagat
ttggctcacatagacagtaaggaggttgaagatctgttctcaggggtacttagtccagag
ggtcatcatcacgctggctctacaaacacaccaacctcaggtgttgatggcaatgcaaca
aacactgctacgccaagcacagtctcccagcagcaacatcaacaccaccatcatcatcat
cagcaacaacaactccagaagcaacctctaccacatcttccgcttacacaacaactggta
caggcggccagtgttgggcactccgtagcaagtcctgctttcagtccagacttcgctgag
ccgcctagcccctggcctggagggggcggtggtggagagactgatggtgaaaccctgtcc
tacaatcagcgtaacatcaagaagtgggagaaggatgaacctctgggtaaccaagctacc
atctcacctgtcctctatgcaaatatcaactaccctgatctcaagaaagattttccagat
tggccttcaagagcaaagcagattgccaagttatggagaaaagcaggctccggaaacaag
aaaccattcttgcaacttgcgagggagaatcgtgccgcacaacgcattaaggaagctcag
aagattcatcaacagaagcgtcagaagtttgatggcgacttgatgagtgatggccaggat
gggtcaggtatcaggccgtcccagcagcagcaattgcagcagggtcagcaaccatctacc
ccaatccctcaggcacaacgtagccctaagtcaatgccaggtacacctattccaggaaca
ccaatgtctcctgctactgaaatgccacattccagcttgatgaacgcaaacagtcaagcc
ttgtctggtcattctggacttcctgtccacatgccactgtccaaccagtcatcgggagcc
gtgaacatggattccatgccaccatctcctatggtagcacaaccatctaacatccatctc
cagtctggaaggagcggaacacccagcatgataccaggaagatctcctcaccattcagaa
gagataagtcatggtgtaatgggtggtgtgaacacacatcagcagcacttggcatccctg
atagcaggacaaggtgctcctccgacatcgtccagcgatcacttgcctgtgtccaacaac
cagtccatcattgataggttacagtctccaggaatgcctcatggctctgcatcacaagtg
cctcctgggataggaaacatgtctccagcacatgcaatgtcggtggggtctccagctcat
gtaatgtcagttgggtctccagctcatgcaatgccagttgatatgcctattcattctcct
cagcaggctcctttcatgaaaaacccagttttcccagatggcgccagcaaccaaagtttg
tcacctgcagcttctgcagcccctgctgacagggtcggaatgaatgatggcaacaagcat
gcacaaaaacagtatattcggcagttattggtgagacagcaggagaaaaaacgtatgcgt
cgggagcagcagcaaatgcaaaatcagaattggagcggagaatcacatcagcgtccccca
cctccctatccagctaatgctccgtcagatcaaatatctcctgctacaaataatgagcaa
atgaactccttccctgggacaccaggcatgccaaggcctgaagcacctccatcatttgtg
aatcaaagaccacaggaacagtttaatatgacccttgagcagacagatgaagcatggagg
caagggcagtttgctacaggccttcagcgtagacctagtgatggtggaaatcgcatccct
ggtcctggacaattcattgaattgaggagatttgagcaaggagcgagaatgccagtgtca
gggccaaccctgtcaccaagaccacgcaacattgccctactccaggagaagctgcatcaa
agagctttacaacaaagaactgccctggttgggtcaaatccattagatccctatgatcat
atggtgaggcagcaagcccatagtaggacacctactccaagacaagtaatgactcatccg
aacttccatggcaggtcacccatgatgtctccaatagtagatcaccctgcccaacaacct
catttgccattccaacagccaactcctcctttccaaggtcaaaacaccaatgcaattcag
aatcaccaacctcgaatccataatgcaatgcctgctcagcaaccaggaacattgcagagc
gaccttcacttgccaccaggtcaagatccagctatggcaccgcagcaggaagaccatgat
gcacaattggaagacttattgtcaggtgaactagatctcattgactttgcaggaactgac
ttggacactaataaacattctgcagaaaatcaacaactcttcaaagattttggtttgagt
gatgaggctcttgatgaaatgaccacatcaagtaacactcctaaagattcaaactcatct
aagattgaaaacggcataccctctgctgctccagagaacaatgaagtacaatctacctcc
actgccggagctagtttggagaaggaaagtgataaggttcctgaagacaaacctgctgct
aatgagcccaaacagactgacagttcaggcttacctgctgatccaaataagaaggaagaa
accagtagctcaggaaggaaagatgcacctaaaacaggaagagacatttctgctacagta
agcagtaacacttctgaagaatcttcttccaaaggtttgatgaaccatgatgataagtcc
gcaacacaatctcaaggaacaaatatttcttctgataaaggttcaaaagagaaaactgtt
gtacatacggatatcacaaatacttcagcatctgttcctactgttcctttgtcaacgtca
gcttctgtgctgcaaacaagtacctcagttccagtgtcagccagtccaagtgaggcactc
actacatccacaacttttttgggtaaagcaacaatcaaaatagaagcaaccgaaaattct
caatcaatttgtcagagaagtaaagttttgactgcccagtctgggcagttaacaacaacg
ataattggttcccaactcgtagagaaacctcagtcccatagccagggacttcaagacaaa
gctagtccaggtacttcatcagtggaaacaaaaacaacattgagctcctctgtcagtgca
ccaagagggggtgtcccaacaattgaccagatagctgccatcttacccggtcctgcatca
aacattcagtcaaacagtacttctcaactgccagttgcttcagttgcctctcagcctaca
accagtgatggcactcagctgcagactagtcaaagttcaggaagcgcccatactaatagt
cttcagaaaaggcaacgtctgctccatgaacaacctcttcttcttcaggatctacttgag
aaagagaagagagagcaacagaagctgcaacagcaatcaggaaatgtggaagcagccatc
tctgggaaggtagatccaaagagcaagacccaaggatctgatccatttctggataatctt
gatctggaaagactgcaggctgaagcaaagatgattgctaaagaaactgaagactttacc
atcaaaccaccaggaccccatgctcagcttttacttgccatgaaccgtcaatatcatgtg
caaatgcaacaacgtcatttaacagagcagcaacccggcgctaatgtgccattgattcct
cctgcttccccaggaatacgacaacctaggactccccaaggtgtagactttggcagtatt
gactctgtcaaggatccaatacggagcaacagcacggacctgttcaagcaaggacagact
gtgcctcctcaaggaatgcaaggaatgtcacacatgaatgctcatggacaggagatgggc
ccattttcccctggccaccctcaaatgcctaatttctcaccaggaccaaggttcagtgct
catgaaaacatccagacacatcccagtcctggaccagtctcgccaatgtcgcccatgacc
cagaatcactttggaatgaggcccaggggtcccatggttgtacagaattctggaatagtg
ggacgcccaccaatgccaggatcaggcatgcatatgcaaggtggacttcctggtgatcag
atgccaatgcagatgcatggcatgcaaaggcttcctggacctggtcagagaatgggaatg
ccagtcatgaacagaatgcctggcccacctcaggtctccaacttcagatttccgggtaga
ttcatgtctcccaacatgcaacgcatgccatctccattcttcaatgtaggaatggatggc
atgtcacatgccatgatgaactttgatccatatgacaccacagaggaaaaggctccagaa
gataccagtactcctgagtatgaagaatggatattcaacaaagacaggaagttacaactc
aggttgaaattctttgaaaacgaagttgggaaagagagaaagaagaagaaggctctgaca
tcaagacagcgagcctgccgtaagaataacaaagtatttcctgaaagtgacaggcttgaa
cttgaagctgtgcagcagagacattctaagcagcagaagttcttggaaaatgttcgcaag
cagcagaggcagcatgccattctcctgcaagaattccgcatgaagcaacaacagaaactg
tcatcgaaccattcacctctgggtcatcacaacccaatgatgcaaggaatgatgtcacct
caaggaatgatgatgcaaggtcaaggcccgaaccctggcatgcacagttcaatgataggc
gggcaacaacatacccttatacctccaggtgggacatcacctaatataccccagcagatg
cttatcaaccaaggaatgcagtctccatctgggtcaatgatgcaggggcctcaatctgga
atgatgccccaaggtcagatgatgggccatgtttcacagcaaattccacatccaatgcga
tcacctatgtctggggaaagacctccatttgctgttagatctggtcagcagtctccaatg
atgcatggaaaccaaataatgcaacctggaaatgcgggaatgatggtcatgcctggacag
actagtccaatggtttcaaatgcaataatgcaaggcagcaacccaatgagtcaggcttca
atgatgccaaacaacaggcaaccatctcctctcatgcctggaagtaatccacagacacca
atgatgcctggcaacaaacctcccacttcgatgattcccattaacagcccacagaccatg
ggtatgccaggaggtaatcaaaccaacatgttacctggaggcatgaacatgccacgtggt
acaaatccacagcaaattcctgtccaaccttcacagcaatcaccaatgtcacatccatcc
catcaggttagcataggtgcctcttcacagcagcagtctcccatgtcagctcaatcacca
atggttccccaatcaccaatggttccccaatcaccaatggttccccaatcaccaatggtt
ccccattctccaatggttccccattctccgatggttccccaatcacccatggttccccat
tctccaatggttcctcactctccaatggtacctcattctccaatggttcctcattctcca
atggtacctcattctccaatggtaccgcattctccgatggttcctcagtcacccatggtt
cacccaggacagcagtcacctgttgtatcatctgggcaacaacagtctccaatgatggga
catcaaagtcaacagaattctcctgctgttcaaaacagtgagcactctcctcttaatgct
ggaagtcaccagtcgccagcagtgacaccaggtgttccatctcccatggtgcccccagga
gcccaatcccctatgatgccccctggaggtcagtcaccattgaagcaggctggtcagcaa
tcccccatggttctagctgatcaacagtctcctatggtttctcagggtcaatcatcaggt
ccaaacagcagccatccctctccaatgatgccacctccttcaccaatgatgactcatcct
ggacaacagtcacctatagcatcatcagcaaatcaaggtcctacaccttctgtcagcggt
cagattcaaatgaggcaagctggaacaccaatgcaatcccctctccaatcaccaatttct
gccaaaacgttaccacagctatctccaattgataagcgcatgccgatcaacatcggacaa
gacaacaatccatttagcgaaacattccaacagagggagagaatggagcgattgcgtgaa
cagcacgagagacaaagattgcagcttgcccaggaactagagcatgttagggctatgcag
agatatgaacaacagcagcagcatcaacaacaacaacaacaccaacaactcaatacttct
catgtatttaatccaagcaggcttcctggtccacatcaagtgcaacaacaaggtaacatg
ggtcaattcagtcagatgcccaatccaggcatggtgtcaccaattagccaagtacctccg
gttcacaacagctctgtaggcatacgtcctccatttccatctccacaagccccattgcag
tcacctgtgcaatcaccatttccaagggagcctttacagcctgggatgatgtcatctcaa
agttcaaccccaactactgaaggtttcccaatgccacctagttacccaggaatgcagacc
aaagtgcaaaagccaaagaaaaagcgagcaaagaagaaaacaagtgatcttttcaaccca
aatccaacttcagtacatcaaagccctgttggggttcttgatgagagctctgttatggca
gcaataggtcattctcaagagaaaggaggaatggtaatgagtgtacagaatatcctccag
cttacttcacctggaagtgcaacacatcaggctttgcagtctattatggctaatgatcca
actgcaagtgtagaccttgccaaactacagcagagccaggccatgttaatgattggagac
atcaatgccaaagctgccaaagatggaattttgaagaacaatcataatcaacttctgaag
caacttctgcaaggaccttcaatttgtgcatcggggatcgtgaaatcagtccccaacaag
acacctgtacagaatcaattgataaaggtcacaggagaaactagcaatgcagaaagtatt
caaacacagcagcattatgattcatcagtggatatgcatgatgaagaaggtcctatcaga
ctcacatcagaacaacagaagcaactggaaataattgaacaactaccatatgtcaagaag
gatgggaagcctgctgaaaatgaccttcaaattctacttgaaattcacagacaaggaaag
attgactatccccctccacaagagcccaaagaaaaggtgccagcaccccctgtaattcca
gcatcgcctcaaccaacagtcaaacagcacaagcacaaggaaaagaaaaagcacaaagag
aaaaaatcaaagaaaaataaggaaagtaggttttcatccgtggaagaactgatggctgct
ctgaagcagatgccaatgctgcagttgactgaacctgaggttggtgtcaacttctccctc
tgtcctctgtttgggagtggaacgactaatggaggaacccggctacgaggggcctttgga
catgctatcttggatggggtgccagacttctatgatcatctgctaacaggctctacctca
gacaccaaactcaaactaccccttggagttgtgaatggaccctcttcactcaaagaaatt
ggatctaaagcacaaggtgacgaggtcatgcgagagatgcagtcacaccagcgcacaata
actcgcaccatgaatcatgcatacagcgggggagggggactcgcccacctagtcgcccca
tcaccctctctctcacaagtagtagccgatatagtgatctcctcatcacctgaatgcgaa
gagaatgaggcccaggagccaagcaagatgaaaggactacgtctgttcacccaggatgtg
gatcaggtcttggcagctcagaagcggtcaggatcacccaccattccaatcataaaacca
actccaaggaaggctgaagcggggtctttgggaaatgccaacactgtccaggtgaccttg
aagctgatgccggaagtaatgcacaacgtggagggggttctctctgcattctctaagctc
ctagggatcaaagaaccatcaaactttgaagtcatcgacgaagccgggcagaaagaacgg
agagggaagtgggcccagagcacaagccctgttgcagatgtggcattgaaaatatcccca
gagaaaatttcagcgtcacctacttcacttacaacttcagtcaagcctaccaagattacc
tctaagtcatctgtgctggctgggtcattagacgaccctaaactgcacttctgcagacac
tgcgatgtccttgttgtaggagagggtgtccgtaaatctgcaacacccactgacaagaac
gtggtcttctgcagtggtgcatgctacctccagcacaccatctcgttacggtcacaggtg
gcacgcaccgaagtcaatgcaggacgagtggtcaatcacaggagctctgatcctcagtct
gttcagctggatgtcctgtcacccaaagccagcacctccctgccaacatcaccctgcacc
gtgccaaagacaccacctcagtccaagtcaacgcccatctctcctcgctccctacctgct
cagcctgttgtctcctcgcccatggctgcacagccagcacacacctctgcagagggaacc
accgctactccatcatctaatcaagaggtctcaccagccaaggaagagaagatggtgact
gatgcagatgagatgaaggtcatcatcagtgagtcaaagacaggtgaaagtggcagggag
gaattgagactgacactgaagactggaacaaggagaagacctgcacttggagatgaattg
cctttggtgaagaaatggaagaacatcaaatggcgccgctggcatggttcattctctggt
ggcaagaaatacagaccacctagtgatcaggatatcggccagttgatcaagaagttggga
acatcaatgagaacaagtgaaactctgcgtgatgccaggtgctgtgtgctctgtaacgga
ttcggagacggagacacaaatggctcggcaaggttgctgaacctgaacgtagacacgtgg
gttcatctgaactgtgctctgtggtctgatgaggtgtatgagaccctcaatggctccctc
atgaacgtggagtctgctctcaagcgagggcgcacctgtacctgctgctactgcagcaag
ctcggtgccaccatctcctgcaataaacaacgttgctgcaatgtctaccacttctcctgc
gccatgcaggaccactgtatgttcttcaaggataagacaatgatgtgcccacttcatgcc
ccatccaaacctacggagagcaccttgcagtctcatgtggtcttcagaagagtctacatt
agcagagatgaacataaacaagttgcaaacatcatgacgatggcagaccgcaagtacaca
gtgcgtgtgggtagtctgatcttcaagtcactagggcagcttctacctcatcagatgcac
ctgttccattcactcacttccatctatcctgttggttacgaatccatccgcctgtactgg
agcatgcgctacaccaacaagcgatgcagttactcctgcaccatccaggaccagggtggg
aggcctgagttcagcatccgcatcatggaacaggggcatgaagacatcatcttcagggcc
gacactccaaggaatgtatggtacaaggtccttgagcccattgctaaactgagacgagat
gcagacatgctcaaagtcttcccaaccttcttgactggtgaagacctctttggcttgacc
gaggcagctatccagaggattactgaatcgctgcctggagtagacctgattcagcactac
accttccggtttggccgttcacctctgattgatctacccctggctgtcaatcctactggg
tgtgccagggcagaaccaaggagacagacccatctcaagagaccgcatacattgacaagc
aacaagacatcccgaggcttccacaccaccctagccggtgaggtagcatctccttacaac
aagcagtttgtacactccaagtcatcacagtacaagaggttgaagactgagtggaagacc
aatgtctacctcgcaaggtcacagatccagggcttggggttgtatgctgctcatgacatc
gagaagcacaccatggtcattgagtacatcggcaccctcatccgcaatgaggtcgccaac
aagtgggaacgcgactacgaagctgcgaaccgcggcgtctacatgttccgcattgatgac
tacaccgtagtggacgccacaaggagtggcaaccctgcccgctacatcaaccactcctgc
aaccccaactgtgtggcagaggtggtgaactttgacaaagaccagaagaagatcatcatc
atctctagcaggagactgctgaagggtgaagagcttacctatgactacaagtttgagatt
gagaatgaccagaacaagatcccctgtctctgtaaggcacccaactgccgcaaatggatg
aattga

DBGET integrated database retrieval system