KEGG   Strongylocentrotus purpuratus (purple sea urchin): 591137Help
Entry
591137            CDS       T01019                                 

Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 7
  KO
K04431  
mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Protein processing in endoplasmic reticulum
Module
MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:spu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    591137
Enzymes [BR:spu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     591137
Protein kinases [BR:spu01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   591137
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 302 aa AA seqDB search
MNRRDQRFYIAFCRPAPRYGQRGLPTLPLQLNHNGGLSPHARRDKKQVQMPLTCGPINRS
TIDGPEIDRKLQEIMKQTGLLTTEGKRYHINVESLESIGELGFGSCGHVIRMRHKESGTI
LAVKQMRRSGNKEENKRILMDLDVVLKSHNCPFIVQCLGAIVTPSEVWICMEQMATCLDK
LIKKLREPVPEQIIGKMVVAIVNALNYLKEKHGVMHRDVKPSNMLLDEKGVVKLCDFGIS
GRLVDSKARTRSAGCAAYMAPERIDPPDPNNPDYDVRADVWSLGISLVTISFASYITIRE
AY
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgtcgagatcagagattttacattgccttttgtcggcctgctccaagatatggc
caaagaggactgccgactcttcctcttcaactaaatcacaatggagggttatcaccgcac
gcaaggagggacaagaaacaagtacaaatgccgctaacatgtggacctatcaacagaagt
acaatagacgggcctgaaattgacaggaagttgcaggaaataatgaaacagactggactt
ttgacaacagagggcaagcgttatcacataaatgtggagagtcttgagtcgataggggaa
cttggttttggaagctgcggccatgtgattcgtatgaggcacaaggagagtggtacaata
ctagcagtgaagcaaatgaggaggtctggaaacaaagaggagaacaagagaattctaatg
gacttggatgttgtactcaaaagtcataattgccctttcatcgtgcaatgcttaggggcc
atagtaacgcctagtgaagtgtggatttgcatggagcagatggccacatgcctggacaaa
ctcatcaagaaactcagagaacccgttccagagcagatcatcggtaaaatggttgtggca
attgtgaatgcgctgaactacctgaaagagaaacatggtgtaatgcacagagacgtgaag
ccgtcaaacatgctcctagatgagaagggcgtggtcaagctatgtgactttggtatcagc
ggcagactagtcgacagcaaggccaggacgaggagtgctggatgtgcagcatacatggcg
ccggagcgaatagacccaccagatccaaataatcctgactatgatgtcagagccgatgtc
tggagtctaggaatttcactggtaactatttcatttgcatcatatattacaattagagaa
gcgtattga

DBGET integrated database retrieval system