KEGG   Strongylocentrotus purpuratus (purple sea urchin): 591292Help
Entry
591292            CDS       T01019                                 

Definition
dual specificity testis-specific protein kinase 2-like
Orthology
K08842  
testis-specific kinase 2 [EC:2.7.12.1]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Enzymes [BR:spu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     591292
Protein kinases [BR:spu01001]
 Serine/threonine protein kinases: TKL group
  LISK family [OT]
   591292
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 574 aa AA seqDB search
MTTDVRLVTLDAMPSTTEDSSNSNTLYTQREDEEGEGGEDAPSPLVNQTLPHHPGKPHRR
YSTQPQDLKVRCRTSSGDSNNSLVFGARTSPLMNIVFLDDFVKEEIGSGFFATVYKLQHR
DTGQVMAAKINTNQNNWDNVHHEIQLISRLVHPNINRFMGLCIHEGSLHPLLEFVNGGTL
TDLLCDNQVYLSWIVRISLASDIAGAMAYLHKKAIMHRDLTSSNVLIKRTGLDMKAIICD
LGLSCRFPRELSSLKSPVGTPFWMAPECLHYKPYDEKIDVFSFGICLCEMIARVTADPDE
LPRINDFGLDEVGFQSISSGCPEPLLELAFSCCKMNKNSRPAFVDIEFQLQHIKIKLGRN
DRLMTDKGDKTTRSRRHTVYLNVPNTPNAPAVQQPRKHPLVRSNSDRGARDRRHSRQMNR
TNPFDTPSLNGGRTKFVNSGRDQLKQLSPDMSLDIGQVLSTLFGRTDIMSIFEQPIKRRL
SVSLPSSPELHRRELSMEDDDFYDDLMSWPSSSDTFELSTSRTPPPPDDASPPYGVGESA
ESASCSSAQDDTTLNGGEPHNSNRNGPNSNDNRR
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgacaacggatgtgagactggttactctggatgccatgccgtctaccactgaagactct
tcaaacagtaacaccctctacacgcagagggaagatgaggaaggggaaggaggggaggat
gccccctcaccccttgtcaaccagaccctcccccatcacccaggcaaacctcaccggagg
tactccacccaaccacaagacttgaaagtgagatgccgcacatcctccggagactccaac
aattctcttgtctttggagcaagaacatctcctctcatgaacattgtcttcctggacgac
ttcgtcaaagaggagataggaagtggcttctttgccactgtttacaagctgcagcatcga
gacactggacaggtgatggctgctaagatcaacacgaatcagaataactgggataatgta
caccatgaaatacaactcattagtcgcttggtacaccctaacatcaacaggtttatggga
ctctgcatccatgagggcagtctgcatccacttttagagtttgtcaacggaggaacgtta
acagacctgctttgtgacaaccaagtttacctatcatggatcgtaaggattagcttagcg
tcggacatcgctggagctatggcttaccttcacaagaaagctattatgcacagggatcta
acatcatcaaacgttctaatcaagagaactggtttggacatgaaggccattatttgtgat
ttgggactctcttgcaggtttccaagggagttgtctagtctgaagtccccggtaggaact
ccattctggatggccccagagtgtctgcactacaaaccatatgatgagaagattgatgtc
ttctcatttggcatatgtttgtgtgagatgatagcaagagtaacggcagatcctgatgag
cttccaagaattaacgactttggtctagatgaagtaggcttccagtcgatcagttcaggt
tgtccagagcctctcttagaactagctttttcctgttgcaagatgaataagaacagtaga
ccagcgtttgtagatattgagtttcaactgcagcatatcaagatcaagcttggacggaac
gacaggctgatgacggacaaaggtgataaaaccacaagatctcggcgtcacaccgtttat
ttgaatgttcctaacacacccaacgccccagcagtgcagcaaccgcgtaagcatccttta
gtacgaagcaactcggacagaggggcacgggatcgcaggcattcgcgccaaatgaaccga
acaaatccctttgatacgccatcgttgaacggtggcaggacaaagtttgtgaattcaggt
cgggaccagctgaagcagctgtctccagatatgtccttggacatcggtcaagtgctttcc
accttgtttggaaggacggacatcatgagtatctttgagcagccgataaaaagaagactt
tccgtttccttgccttcgtctccggagctccatcgccgggagctctcgatggaggatgat
gacttctatgatgatctcatgagctggccaagctcgtcggatacctttgaacttagtacg
agtagaacccctccccctccggatgatgcatcacccccgtatggagtgggagagtccgca
gagtcagcatcatgcagcagtgcgcaggatgataccactttaaatggaggggagcctcac
aatagcaatagaaatggaccaaattccaatgataataggaggtag

DBGET integrated database retrieval system