KEGG   Strongylocentrotus purpuratus (purple sea urchin): 591457Help
Entry
591457            CDS       T01019                                 

Gene name
gtf2h4
Definition
general transcription factor IIH, polypeptide 4, 52kDa
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:spu00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    591457 (gtf2h4)
  Replication and repair
   03420 Nucleotide excision repair
    591457 (gtf2h4)
Transcription machinery [BR:spu03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     591457 (gtf2h4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 469 aa AA seqDB search
MATSSEDAFDNSRKLDCKDLHGYLRTLQGSVLDRLYNHPATCLAVFRELPVLGKHCIMRV
LFIDTPIPQAAVTSWIQSNQQEQLHAALKTLTDLRLFRDQSLPGGLPGWLLNLTFRTNLK
TALIGGGKPWAISGKGGKGGKDKKVKETATLDKYSSERWECVLHFLVGSSKAVDTLSRDI
ATVLTHSGLMRLGESGGTPVITPSGFQFLLLDTPSQVWFFMLQYLETSQARGLDIVDALS
FLFQLSFSTLGKDYSSEGMTEQQLHFLQHLRELGLVFQRKRKSMRYYPTRLAINLASGVS
SMAKDDHKDGFIVVETNFRVYAYTESDLQVEILGLFCSMMYRFPNLSVAALTRESVQLAI
SNGITAEQILSFLRTHAHPNMRLKTPIVPPTISDQVRLWELERDRLSFTQGIIYNEFLSL
HDFEVLRDYAKDLGVLIWDSTARRIMIVSPAGHDSVKKYWKRLKKGQVS
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggcgacttccagtgaagatgcatttgataattcaaggaaacttgactgcaaagatctc
catggttatctacggacccttcaaggatctgtcttagatagactttacaatcatcctgca
acatgtctggctgtttttcgtgaacttccagttttgggcaaacattgcatcatgagggtg
ttgttcattgacactcccattccccaagctgcagtcacctcatggatacagagcaaccag
caggaacagcttcatgcagcactgaaaacattgacagatcttcgtctgttcagggaccag
tctttgcccggcggccttccaggatggcttctcaatctcaccttcaggactaatctcaag
actgctcttattggaggaggcaagccatgggccatcagtggaaaaggtggaaaaggtgga
aaggacaagaaagtgaaagaaacagctactcttgacaagtactcttcggaaagatgggag
tgtgtacttcatttcttggtgggctcctccaaggctgtagatacgttgagtcgagatatt
gctaccgtcttgactcattcgggtctcatgagattaggtgaatcgggaggaacgccggtg
atcacaccctctggttttcagttcctgctcctagataccccctctcaggtctggttcttc
atgctgcagtatctagagacctcccaggctcgaggtctagacatcgtagacgctctctcc
ttcctcttccaactcagcttctcaacgttaggaaaagactattcatctgagggcatgact
gagcagcagcttcatttcttgcagcatctgagagagctaggcttagtgttccaaagaaag
aggaagtccatgcgctactacccaaccaggcttgccatcaacttagcttcaggtgtatca
agtatggccaaggatgatcacaaagacggcttcatcgtcgtggaaaccaacttccgtgtc
tatgcctacacagagtcggatctccaggttgaaatactgggactcttttgctctatgatg
tacaggttcccaaacctttctgtggctgctttgacgagggagagtgtacagttagccata
tcgaatggaatcacagctgaacagattctaagtttcttgagaactcatgcacaccctaac
atgagactgaagacacctatcgtacctcctactattagtgatcaggtcagactgtgggag
ctggagagagacagactcagtttcacacaaggtatcatatacaatgagttcttgtctctt
catgactttgaggtgctacgggactatgctaaggaccttggtgtacttatctgggatagt
actgcaagacgcatcatgatcgtttctccggcagggcacgatagtgtcaagaagtactgg
aagcgattgaaaaaaggacaagtgtcgtag

DBGET integrated database retrieval system