KEGG   Strongylocentrotus purpuratus (purple sea urchin): 591892Help
Entry
591892            CDS       T01019                                 

Definition
beta,beta-carotene 15,15'-monooxygenase-like
Orthology
K00515  
beta-carotene 15,15'-monooxygenase [EC:1.14.99.36]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Retinol metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    591892
Enzymes [BR:spu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.36  beta-carotene 15,15'-monooxygenase
     591892
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 540 aa AA seqDB search
MNVVFPRERKQAQLKVISEKISCKLPGWLRGSLVRIGPGLFEVGDTEYKHWFDGLALMHK
FAFHNGKVSYQNRFLRSNAYKKAMKYNKIILSEFGTVGIPDPCKNVLERFATHFLPLNVT
DNNLINMYQLGDEVYTATETHTPRKINLQDLSTEDQTIDLLKMFGMMTASAHAQVDRDGC
SYNMGTSYLTGCFYNIIKFFPKSNSASSSSPSSPSLESSTTSTSESSTDTSSPSMSAKLL
CSIRARNPLKPSYFHSFGMTDNYIVFSEQTLHINVAKLASSQILGKPVSSCFEFDHNGTT
LFHLVEKQTGRQMTTRYETGPLFGMHVINSYEEDGHVVFDICSYDDDELLKKFYLDYLRH
GDQDGKRHFPITEVRRFVLPLRINKNTPVGTNLVTLNYTSASAQLRPDGVVELTYEVASD
IGIDMPCINSRVNGRPYTYAYGTSGKCKGDFMNTIVKCNMRTKSCKTWHRPNHYPSEPIF
VGAPDAVDEDEGVLVSTVISSETQRAFLLVLDAKTLDEIARANIPETMSCPITFHGGFFQ
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgaatgttgtctttccacgagaaaggaaacaggcacaattgaaagttatttcagagaag
atcagctgcaaactccctggctggctccgggggtccctggtgcggattggtccaggtcta
ttcgaagtgggggacacagaatacaagcactggttcgatggtctagccctcatgcacaag
tttgctttccataacggcaaagtgagctaccagaataggttcctccgaagcaacgcgtac
aagaaggcgatgaaatacaacaaaatcatcctctcagagtttggcacagtaggaataccg
gacccctgcaagaacgtcctcgagcgctttgccacccattttctaccgcttaatgttaca
gacaataatttaataaacatgtatcaacttggggatgaggtatacacggcgacagagacg
cacacaccgaggaagatcaacctacaagacctaagcacggaggaccaaacgatcgatctg
ttaaagatgttcggtatgatgacagcgtctgcgcatgctcaggtggacagggacgggtgc
tcgtataacatgggaacatcttacctcaccggctgcttctacaacatcatcaagttcttc
cctaaatcaaattcagcatcgtcatcgtcaccatcgtcaccgtcattagaaagcagcacg
acgtcaaccagcgagtcgagtacagacacgagcagtccttcgatgtcggctaaactgctt
tgcagcatccgagcacggaaccctctaaaaccctcgtactttcacagcttcggtatgacc
gacaactacatcgttttctccgagcagaccctccacatcaacgtcgccaaactcgcctcc
tcgcagatactgggcaagccggtgtcgtcgtgtttcgagttcgaccataacggaacgacg
ctctttcatctcgtcgaaaagcagacgggacggcagatgaccacgaggtacgagacgggt
ccgctctttggcatgcacgtgatcaactcctacgaagaggacgggcatgtggtgtttgat
atctgttcgtacgatgacgatgagcttctcaagaaattctaccttgactaccttaggcat
ggagaccaggacggcaagcgacattttccaatcacagaagtcaggagattcgtcttacct
cttagaataaataagaacacacctgttggcacaaacctcgtaactctaaattatacatca
gcttctgcacaacttcggcctgacggcgttgtagaactcacctatgaagtcgcctcagat
attgggatcgatatgccatgcataaacagtagagtcaatggaaggccctacacatatgct
tacggaacttcggggaaatgtaaaggcgactttatgaatacgattgtaaaatgcaacatg
cgaacaaaatcttgcaagacatggcacagaccgaatcactatccgtcagagccgatcttt
gttggggcaccagatgctgtggacgaggatgagggtgttttagtttcaaccgtaatcagc
agcgaaacacaaagggcattcctactggtacttgacgctaagacattagatgaaatagca
cgggcaaatatccccgagacaatgtcatgtcccatcaccttccacggcggattcttccaa
tga

DBGET integrated database retrieval system