KEGG   Strongylocentrotus purpuratus (purple sea urchin): 591892Help
Entry
591892            CDS       T01019                                 

Definition
(RefSeq) beta,beta-carotene 15,15'-monooxygenase
  KO
K00515  
beta-carotene 15,15'-dioxygenase [EC:1.13.11.63]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Retinol metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    591892
Enzymes [BR:spu01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.63  beta-carotene 15,15'-dioxygenase
     591892
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 546 aa AA seqDB search
MANSDPNFGCLFNSVQREYPTPVAAQVKGKLPGWLRGSLVRIGPGLFEVGDTEYKHWFDG
LALMHKFAFHNGKVSYQNRFLRSNAYKKAMKYNKIILSEFGTVGIPDPCKNVLERFATHF
LPLNVTDNNLINMYQLGDEVYTATETHTPRKINLQDLSTEDQTIDLLKMFGMMTASAHAQ
VDRDGCSYNMGTSYLTGCFYNIIKFFPKSNSASSSSPSSPSLESSTTSTSESSTDTSSPS
MSAKLLCSIRARNPLKPSYFHSFGMTDNYIVFSEQTLHINVAKLASSQILGKPVSSCFEF
DHNGTTLFHLVEKQTGRQMTTRYETGPLFGMHVINSYEEDGHVVFDICSYDDDELLKKFY
LDYLRHGDQDGKRHFPITEVRRFVLPLRINKNTPVGTNLVTLNYTSASAQLRPDGVVELT
YEVASDIGIDMPCINSRVNGRPYTYAYGTSGKCKGDFMNTIVKCNMRTKSCKTWHRPNHY
PSEPIFVGAPDAVDEDEGVLVSTVISSETQRAFLLVLDAKTLDEIARANIPETMSCPITF
HGGFFQ
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggctaattcggatcccaattttggatgtctattcaactctgttcaaagggaatatccc
acaccggtcgcagcacaagttaaaggcaaactccctggctggctccgggggtccctggtg
cggattggtccaggtctattcgaagtgggggacacagaatacaagcactggttcgatggt
ctagccctcatgcacaagtttgctttccataacggcaaagtgagctaccagaataggttc
ctccgaagcaacgcgtacaagaaggcgatgaaatacaacaaaatcatcctctcagagttt
ggcacagtaggaataccggacccctgcaagaacgtcctcgagcgctttgccacccatttt
ctaccgcttaatgttacagacaataatttaataaacatgtatcaacttggggatgaggta
tacacggcgacagagacgcacacaccgaggaagatcaacctacaagacctaagcacggag
gaccaaacgatcgatctgttaaagatgttcggtatgatgacagcgtctgcgcatgctcag
gtggacagggacgggtgctcgtataacatgggaacatcttacctcaccggctgcttctac
aacatcatcaagttcttccctaaatcaaattcagcatcgtcatcgtcaccatcgtcaccg
tcattagaaagcagcacgacgtcaaccagcgagtcgagtacagacacgagcagtccttcg
atgtcggctaaactgctttgcagcatccgagcacggaaccctctaaaaccctcgtacttt
cacagcttcggtatgaccgacaactacatcgttttctccgagcagaccctccacatcaac
gtcgccaaactcgcctcctcgcagatactgggcaagccggtgtcgtcgtgtttcgagttc
gaccataacggaacgacgctctttcatctcgtcgaaaagcagacgggacggcagatgacc
acgaggtacgagacgggtccgctctttggcatgcacgtgatcaactcctacgaagaggac
gggcatgtggtgtttgatatctgttcgtacgatgacgatgagcttctcaagaaattctac
cttgactaccttaggcatggagaccaggacggcaagcgacattttccaatcacagaagtc
aggagattcgtcttacctcttagaataaataagaacacacctgttggcacaaacctcgta
actctaaattatacatcagcttctgcacaacttcggcctgacggcgttgtagaactcacc
tatgaagtcgcctcagatattgggatcgatatgccatgcataaacagtagagtcaatgga
aggccctacacatatgcttacggaacttcggggaaatgtaaaggcgactttatgaatacg
attgtaaaatgcaacatgcgaacaaaatcttgcaagacatggcacagaccgaatcactat
ccgtcagagccgatctttgttggggcaccagatgctgtggacgaggatgagggtgtttta
gtttcaaccgtaatcagcagcgaaacacaaagggcattcctactggtacttgacgctaag
acattagatgaaatagcacgggcaaatatccccgagacaatgtcatgtcccatcaccttc
cacggcggattcttccaatga

DBGET integrated database retrieval system