KEGG   Strongylocentrotus purpuratus (purple sea urchin): 592241Help
Entry
592241            CDS       T01019                                 

Definition
thymidine phosphorylase-like
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Pyrimidine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:spu00240]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:spu00983]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 436 aa AA seqDB search
MPPVKSPNGDGGEPLNAVTGKASAAAAAAAAGSPRHFRFTDIMEKKLNGGTWTEDEIKWF
ISEIVKTDGTIEASQIGAFLMCTFIKGLNAEETACLTKAMMLSGDTLSWPKEWEGTLVDK
HSTGGVGDKVSLILAPALAACGMKVPMISGRGLGHTGGTLDKLESIPGYTVHLQSERMRK
IMEDVGCCICGQTANLVPADKILYGIRDVTSTVSSLPLITGSIISKKAAESVNALVLDVK
VGKSAIFSQDETLGREMATSLVSQECGCLIDSLLQGTCNGKQQISDTLDNGTALAKFQDM
IIAQGVDGCLAKRLCGLPMDNIDEVWQVLKKAENKTQLKAEKTGYISSINSLELAKVCLE
LGAGRAVATAAVDHSVGVNLLAHVGSHVKKGESWVTVYHQASDFTEKLSNRLQATLEYSD
HPVSVPNIVIDVVRPS
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgccgccagtgaaatctccgaatggtgacggaggcgagcctctgaatgcggtcacagga
aaggcctccgctgctgccgctgccgctgcggcggggtcgccgaggcacttccgtttcact
gatatcatggagaagaaattgaatggcggaacgtggaccgaagatgagataaaatggttc
atctcggaaatagtgaaaacggatggaacaattgaagccagtcaaattggggccttcttg
atgtgtaccttcattaaggggttgaacgcagaggagacggcctgcctcaccaaggccatg
atgctgagtggtgataccctgagctggcccaaggagtgggagggtacactggtagacaag
cattctaccggtggagtgggcgacaaagtgagcctcatcctcgcccctgctctggctgcc
tgcgggatgaaggtaccgatgatttcagggcgcggcctgggccataccgggggcaccttg
gacaagctggagtctatccctggatacaccgtccacctccaatcagagcggatgcgtaag
atcatggaggacgtcggatgctgcatctgcggtcagacggccaatctcgtccctgccgac
aagattctctacggtatccgagatgtcacgagtaccgtgtcaagcttgcctctcatcaca
ggctctatcatatctaagaaggcagcagagagtgtgaatgctctggtgctggacgtcaaa
gtgggcaagtctgccatcttctctcaggatgaaacgcttgggagggaaatggctacatca
ttggtgagtcaggagtgtggatgtctgattgactctcttcttcaaggcacctgcaatggc
aaacaacagatttcagacacccttgataatggaacagccctggccaaattccaggacatg
attatagcccagggtgtcgatgggtgcctggccaaacggctctgcgggctacccatggac
aacattgatgaggtctggcaagttctaaagaaggctgaaaacaagacccagctgaaggcg
gagaaaacaggctatatctccagcatcaactcactggagttggccaaagtgtgcctggaa
ctaggagctggacgagccgttgccacggcagccgttgaccactctgttggggtcaatctg
ctggctcatgtggggtcacatgtcaagaaaggagagtcctgggtcactgtgtaccaccag
gcttcggacttcactgagaaactatccaacagacttcaggctacccttgagtattcagac
catccagtctcagtcccaaacattgtcattgatgttgtcaggccatcctaa

DBGET integrated database retrieval system