KEGG   Strongylocentrotus purpuratus (purple sea urchin): 592241Help
Entry
592241            CDS       T01019                                 

Definition
(RefSeq) thymidine phosphorylase
  KO
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Pyrimidine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    592241
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    592241
Enzymes [BR:spu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     592241
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 501 aa AA seqDB search
MGRTRSQKKTGPAYVQNGTRNQGSVKRSASCLIAAQEISNVKRKVMRTMPPVKSPNGDGG
EPLNAVTGKASAAAAAAAAGSPRHFRFTDIMEKKLNGGTWTEDEIKWFISEIVKTDGTIE
ASQIGAFLMCTFIKGLNAEETACLTKAMMLSGDTLSWPKEWEGTLVDKHSTGGVGDKVSL
ILAPALAACGMKVPMISGRGLGHTGGTLDKLESIPGYTVHLQSERMRKIMEDVGCCICGQ
TANLVPADKILYGIRDVTSTVSSLPLITGSIISKKAAESVNALVLDVKVGKSAIFSQDET
LGREMATSLVSQECRMGGDNRERKRERERMGGCLIDSLLQGTCNGKQQISDTLDNGTALA
KFQDMIIAQGVDGCLAKRLCGLPMDNIDEVWQVLKKAENKTQLKAEKTGYISSINSLELA
KVCLELGAGRAVATAAVDHSVGVNLLAHVGSHVKKGESWVTVYHQASDFTEKLSNRLQAT
LEYSDHPVSVPNIVIDVVRPS
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgggccgtacgagaagtcagaaaaagactggaccggcttacgttcaaaatggtacacgc
aaccaagggtcagttaagcgttctgcaagttgtcttatagcggcacaagaaatttctaac
gtgaaaagaaaggttatgcggacgatgccgccagtgaaatctccgaatggtgacggaggc
gagcctctgaatgcggtcacaggaaaggcctccgctgctgccgctgccgctgcggcgggg
tcgccgaggcacttccgtttcactgatatcatggagaagaaattgaatggcggaacgtgg
accgaagatgagataaaatggttcatctcggaaatagtgaaaacggatggaacaattgaa
gccagtcaaattggggccttcttgatgtgtaccttcattaaggggttgaacgcagaggag
acggcctgcctcaccaaggccatgatgctgagtggtgataccctgagctggcccaaggag
tgggagggtacactggtagacaagcattctaccggtggagtgggcgacaaagtgagcctc
atcctcgcccctgctctggctgcctgcgggatgaaggtaccgatgatttcagggcgcggc
ctgggccataccgggggcaccttggacaagctggagtctatccctggatacaccgtccac
ctccaatcagagcggatgcgtaagatcatggaggacgtcggatgctgcatctgcggtcag
acggccaatctcgtccctgccgacaagattctctacggtatccgagatgtcacgagtacc
gtgtcaagcttgcctctcatcacaggctctatcatatctaagaaggcagcagagagtgtg
aatgctctggtgctggacgtcaaagtgggcaagtctgccatcttctctcaggatgaaacg
cttgggagggaaatggctacatcattggtgagtcaggagtgtaggatgggaggagataac
agagagagaaagagagagagagagagaatgggtggatgtctgattgactctcttcttcaa
ggcacctgcaatggcaaacaacagatttcagacacccttgataatggaacagccctggcc
aaattccaggacatgattatagcccagggtgtcgatgggtgcctggccaaacggctctgc
gggctacccatggacaacattgatgaggtctggcaagttctaaagaaggctgaaaacaag
acccagctgaaggcggagaaaacaggctatatctccagcatcaactcactggagttggcc
aaagtgtgcctggaactaggagctggacgagccgttgccacggcagccgttgaccactct
gttggggtcaatctgctggctcatgtggggtcacatgtcaagaaaggagagtcctgggtc
actgtgtaccaccaggcttcggacttcactgagaaactatccaacagacttcaggctacc
cttgagtattcagaccatccagtctcagtcccaaacattgtcattgatgttgtcaggcca
tcctaa

DBGET integrated database retrieval system