KEGG   Strongylocentrotus purpuratus (purple sea urchin): 592342Help
Entry
592342            CDS       T01019                                 

Definition
ubiquitin carboxyl-terminal hydrolase 5-like
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.4.19.12]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Enzymes [BR:spu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     592342
Peptidases [BR:spu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   592342
Exosome [BR:spu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   592342
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 802 aa AA seqDB search
MAASKLHEFLDKIRIPRAGDKVYKDECAYCFDNPESETGLFVCMNTFLGFGKDYVRRHYE
RTKNPVYLHLKTIKKKKPKTEEEKEKEKPTRLAIGMQGGFDVEDENQYEYEEHNSVVILP
DFTEIPLPNAELPEEVQLSIASILSATSASKAEQIQAWDGEAKILSKHAANLKQLDNGVK
VPXKGWKCSMCDLKDNLWMNLTDGTILCGRRYFDGTGGNNHAVEQYDQTKYPLAVKLGTI
TPNGADVYSYVEDEMVDDPLLATHLTHFGINMMNMEKTDKTMTELEIDLNMRVAEWDTIQ
ESGSQLKPLFGPGLTGLKNMGNSCYLNSVMQVLFSIPDFVNRYASKKDEIFTSAPADPRG
DFNVQMAKLGYGLASGRYSQEPKTTDSGDQSEAKKQSGVAPRMFKSLVGKGHQEFSTNRQ
QDAQEYLLHLFSIIERHSRNLNNPCDCLQLELEERIQCSQSNQVKYKKRTDYILAVPIPL
EAATNLTAFLSYEAKKAKLEAKKERVDPKDIVRPNICLKDCLEAFAAQEKVEDFYSAAIN
AKTVALRSTRIASFPDFLIIQLKKFTLGEDWTPMKLDVSVDMPDELDLSRYRGNGIQPGE
TELPDGDGPPEPEPVIDEGMVSLLAEMGFAKEGCRKAVYHTKNTGTDAAMNWIFEHSADP
DFAEPLQLGQAKKKQKTEIVASEEGIMMIMSMGFTREQSIKALRATDNNLERAADWIFSH
PDELLDTPMETEQPSGPTCRDGNGKYQLFAFVSHMGTSTACGHYVCHIKKEGRWVIFNDD
KVAQSEKPPKDLGYIYFYKRLN
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atggcagcttccaaattgcacgagtttcttgacaaaatcagaataccgagagctggagat
aaagtgtataaggatgagtgtgcatattgtttcgataatccggaaagtgagacaggcttg
tttgtgtgtatgaacacatttcttgggtttggaaaggactacgttcggaggcactatgaa
cgcaccaagaaccctgtctatcttcatctcaagacaattaaaaagaagaaaccaaaaaca
gaagaagagaaagagaaggagaagccaacaagacttgccataggaatgcaaggaggtttc
gatgtagaagatgagaaccagtatgagtatgaagaacacaactctgtagtcatcttacca
gacttcactgagattccgcttcccaatgctgaactgcctgaagaggtccagctttctatt
gccagtatcctgtcggctacctcagcttctaaagcagaacaaattcaagcctgggatgga
gaagcaaagattctctctaaacatgcagctaatctcaaacaactggacaacggtgttaag
gtaccgcncaagggttggaagtgcagcatgtgtgacctgaaggacaacctgtggatgaac
ctgaccgatgggaccatactctgcgggaggcgatacttcgacgggacgggaggcaacaac
cacgctgtcgaacagtacgaccagaccaaatatcccttagccgtgaaactaggcacgata
actccaaatggagcagatgtgtattcctatgtcgaggatgagatggtcgatgatccacta
ctagcaactcatctaactcactttggcatcaacatgatgaacatggagaagactgacaag
accatgacggagctagagatagacctgaacatgagagttgctgaatgggacaccatccag
gagtctggttctcaactcaagcctctgtttggacctggtctaactggacttaaaaacatg
ggcaatagttgttacctgaactcggtcatgcaagttctctttagtattcctgactttgta
aatagatatgcttccaagaaggacgagatctttacgagtgctcctgcagatccgaggggg
gacttcaatgtacaaatggccaagcttggttacgggttagcttcaggacgatactcgcag
gaacccaagacgacagacagtggagaccagtccgaagcaaagaagcagagtggtgttgcc
cccaggatgttcaagagccttgtgggtaaaggtcaccaagagttctctaccaacagacaa
caagatgctcaagaatatcttcttcatctcttcagcatcattgagaggcacagtagaaat
ctaaacaatccatgcgactgtctccagcttgagctagaggagaggattcaatgttcacaa
tctaatcaggttaaatacaagaaaagaactgactacatcctagctgtaccaataccacta
gaggctgccacaaacctaactgcattcctttcttacgaagcaaagaaagcaaagttggaa
gccaagaaggagagggtcgatccaaaggatatcgtccgtcccaacatctgcctaaaagac
tgcctcgaggccttcgccgcacaggagaaagtagaggacttctacagtgcggctataaat
gccaagacagtggcactcaggtcaaccagaatagcctcattcccagacttcctcatcatc
caactcaagaaattcacgttaggggaggactggacgcccatgaaacttgatgtatcagta
gacatgcctgatgagcttgacctgagccgctaccgagggaacggtatacagccaggtgag
accgaactacctgacggagatggaccaccagaaccagaacctgttattgatgagggcatg
gtaagtctcctggcagagatgggttttgccaaagagggctgtcgtaaagctgtctaccat
accaagaacacaggcacagatgctgctatgaattggatttttgaacactcagctgatcca
gattttgcagagccattgcagcttggtcaagcaaagaagaagcaaaagacagagattgta
gcgagcgaggaagggatcatgatgatcatgagtatgggtttcaccagagagcaatctatc
aaggcgcttagagcaacggacaataacctagagagggcagcagactggatattcagtcat
ccagatgagcttcttgacacaccaatggaaactgaacaaccaagtggacccacatgtcgg
gatggtaatggaaaataccaactgtttgcttttgtgagtcacatggggacatctacagca
tgtggtcactatgtgtgccatatcaagaaagaaggaagatgggtgatcttcaatgatgac
aaggttgcgcaatcggagaaacctcccaaggacctaggttacatctacttctacaagagg
ctgaactga

DBGET integrated database retrieval system